Recombinant Human ANGPT2 Protein
Cat.No. : | ANGPT2-484H |
Product Overview : | Recombinant human ANGPT2 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 496 |
Description : | This gene belongs to the angiopoietin family of growth factors. The protein encoded by this gene is an antagonist of angiopoietin 1, and both angiopoietin 1 and angiopoietin 2 are ligands for the endothelial TEK receptor tyrosine kinase. Angiopoietin 2 is upregulated in multiple inflammatory diseases and is implicated in the direct control of inflammation-related signaling pathways. The encoded protein affects angiogenesis during embryogenesis and tumorigenesis, disrupts the vascular remodeling ability of angiopoietin 1, and may induce endothelial cell apoptosis. This gene serves a prognostic biomarker for acute respiratory distress syndrome. |
Form : | Lyophilized |
AA Sequence : | MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | ANGPT2 angiopoietin 2 [ Homo sapiens (human) ] |
Official Symbol | ANGPT2 |
Synonyms | ANGPT2; angiopoietin 2; angiopoietin-2; Ang2; ANG-2; Tie2-ligand; angiopoietin-2B; angiopoietin-2a; ANG2; AGPT2; |
Gene ID | 285 |
mRNA Refseq | NM_001118887 |
Protein Refseq | NP_001112359 |
MIM | 601922 |
UniProt ID | O15123 |
◆ Recombinant Proteins | ||
ANGPT2-2711H | Recombinant Human ANGPT2 Protein (Met1-Phe496), C-His tagged | +Inquiry |
ANGPT2-325R | Recombinant Rat ANGPT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANGPT2-523HB | Recombinant Human ANGPT2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
ANGPT2-1666M | Recombinant Mouse ANGPT2 protein, His-tagged | +Inquiry |
ANGPT2-415H | Active Recombinant Human ANGPT2 Protein (Met1-Phe496), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANGPT2-2228HCL | Recombinant Human ANGPT2 cell lysate | +Inquiry |
ANGPT2-001MCL | Recombinant Mouse ANGPT2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPT2 Products
Required fields are marked with *
My Review for All ANGPT2 Products
Required fields are marked with *
0
Inquiry Basket