Recombinant Human ANGPTL1 protein, GST-tagged

Cat.No. : ANGPTL1-553H
Product Overview : Human ANGPTL1 full-length ORF ( AAH50640, 24 a.a. - 491 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro. [provided by RefSeq, Jul 2008]
Molecular Mass : 77.22 kDa
AA Sequence : GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVLQLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDGSVNFFRNWENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEPESEFYRLRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVWYRGGHYRSKHQDGIFWAEYRGGSYSLRAVQMMIKPID
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANGPTL1 angiopoietin-like 1 [ Homo sapiens ]
Official Symbol ANGPTL1
Synonyms ANGPTL1; angiopoietin-like 1; ANGPT3; angiopoietin-related protein 1; ANG3; angioarrestin; AngY; ARP1; ANG-3; angiopoietin 3; angiopoietin-3; angiopoietin Y1; angiopoietin-like protein 1; dJ595C2.2 (angiopoietin Y1); UNQ162; dJ595C2.2; KIAA0351;
Gene ID 9068
mRNA Refseq NM_004673
Protein Refseq NP_004664
MIM 603874
UniProt ID O95841

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANGPTL1 Products

Required fields are marked with *

My Review for All ANGPTL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon