Recombinant Human AP1M2 protein, GST-tagged
Cat.No. : | AP1M2-648H |
Product Overview : | Human AP1M2 full-length ORF ( NP_005489.2, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 74.5 kDa |
AA Sequence : | MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEEESIRDNFVIVYELLDELMDFGFPQTTDSKILQEYITQQSNKLETGKSRVPPTVTNAVSWRSEGIKYKKNEVFIDVIESVNLLVNANGSVLLSEIVGTIKLKVFLSGMPELRLGLNDRVLFELTGRSKNKSVELEDVKFHQCVRLSRFDNDRTISFIPPDGDFELMSYRLSTQVKPLIWIESVIEKFSHSRVEIMVKAKGQFKKQSVANGVEISVPVPSDADSPRFKTSVGSAKYVPERNVVIWSIKSFPGGKEYLMRAHFGLPSVEKEEVEGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AP1M2 adaptor-related protein complex 1, mu 2 subunit [ Homo sapiens ] |
Official Symbol | AP1M2 |
Synonyms | AP1M2; adaptor-related protein complex 1, mu 2 subunit; AP-1 complex subunit mu-2; AP1 mu2; HSMU1B; mu2; mu-adaptin 2; mu1B-adaptin; HA1 47 kDa subunit 2; AP-mu chain family member mu1B; golgi adaptor AP-1 47 kDa protein; clathrin coat assembly protein AP47 2; clathrin coat associated protein AP47 2; adaptor protein complex AP-1 mu-2 subunit; golgi adaptor HA1/AP1 adaptin mu-2 subunit; clathrin-associated adaptor medium chain mu2; adaptor-related protein complex 1 mu-2 subunit; clathrin assembly protein complex 1 medium chain 2; MU1B; MU-1B; AP1-mu2; |
Gene ID | 10053 |
mRNA Refseq | NM_005498 |
Protein Refseq | NP_005489 |
MIM | 607309 |
UniProt ID | Q9Y6Q5 |
◆ Recombinant Proteins | ||
AP1M2-11734Z | Recombinant Zebrafish AP1M2 | +Inquiry |
AP1M2-648H | Recombinant Human AP1M2 protein, GST-tagged | +Inquiry |
AP1M2-1734M | Recombinant Mouse AP1M2 Protein | +Inquiry |
AP1M2-183H | Recombinant Human AP1M2 Protein, His-tagged | +Inquiry |
AP1M2-1097HF | Recombinant Full Length Human AP1M2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP1M2-86HCL | Recombinant Human AP1M2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP1M2 Products
Required fields are marked with *
My Review for All AP1M2 Products
Required fields are marked with *