Recombinant Human AP1S1 protein, His-tagged

Cat.No. : AP1S1-8272H
Product Overview : Recombinant Human AP1S1 protein(1-127 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-127 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTS
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol AP1S1
Synonyms AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assembly/adaptor protein; small 1 (19kD); golgi adaptor HA1/AP1 adaptin sigma 1A subunit; HA1 19 kDa subunit; SIGMA1A; sigma1A subunit of AP 1 clathrin adaptor complex; sigma1A adaptin; WUGSC:H_DJ0747G18.2; sigma1A-adaptin; sigma-adaptin 1A; sigma 1a subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1A subunit; golgi adaptor HA1/AP1 adaptin sigma-1A subunit; sigma1A subunit of AP-1 clathrin adaptor complex; adapter-related protein complex 1 sigma-1A subunit; clathrin assembly protein complex 1 sigma-1A small chain; clathrin-associated/assembly/adaptor protein, small 1 (19kD); FLJ92436;
Gene ID 1174
mRNA Refseq NM_001283
Protein Refseq NP_001274
MIM 603531
UniProt ID P61966

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP1S1 Products

Required fields are marked with *

My Review for All AP1S1 Products

Required fields are marked with *

0
cart-icon
0
compare icon