Recombinant Human AP1S1 protein, His-tagged
Cat.No. : | AP1S1-8272H |
Product Overview : | Recombinant Human AP1S1 protein(1-127 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-127 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | AP1S1 |
Synonyms | AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assembly/adaptor protein; small 1 (19kD); golgi adaptor HA1/AP1 adaptin sigma 1A subunit; HA1 19 kDa subunit; SIGMA1A; sigma1A subunit of AP 1 clathrin adaptor complex; sigma1A adaptin; WUGSC:H_DJ0747G18.2; sigma1A-adaptin; sigma-adaptin 1A; sigma 1a subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1A subunit; golgi adaptor HA1/AP1 adaptin sigma-1A subunit; sigma1A subunit of AP-1 clathrin adaptor complex; adapter-related protein complex 1 sigma-1A subunit; clathrin assembly protein complex 1 sigma-1A small chain; clathrin-associated/assembly/adaptor protein, small 1 (19kD); FLJ92436; |
Gene ID | 1174 |
mRNA Refseq | NM_001283 |
Protein Refseq | NP_001274 |
MIM | 603531 |
UniProt ID | P61966 |
◆ Recombinant Proteins | ||
AP1S1-1735M | Recombinant Mouse AP1S1 Protein | +Inquiry |
AP1S1-1036HF | Recombinant Full Length Human AP1S1 Protein, GST-tagged | +Inquiry |
AP1S1-24HF | Recombinant Full Length Human AP1S1 Protein | +Inquiry |
AP1S1-8272H | Recombinant Human AP1S1 protein, His-tagged | +Inquiry |
AP1S1-649H | Recombinant Human AP1S1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP1S1-8817HCL | Recombinant Human AP1S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP1S1 Products
Required fields are marked with *
My Review for All AP1S1 Products
Required fields are marked with *