Recombinant Human AP1S1 protein, GST-tagged

Cat.No. : AP1S1-649H
Product Overview : Human AP1S1 full-length ORF ( AAH03561, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq, Jul 2008]
Molecular Mass : 40.37 kDa
AA Sequence : MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP1S1 adaptor-related protein complex 1, sigma 1 subunit [ Homo sapiens ]
Official Symbol AP1S1
Synonyms AP1S1; adaptor-related protein complex 1, sigma 1 subunit; CLAPS1; AP-1 complex subunit sigma-1A; AP 1 complex subunit sigma 1A; AP19; clathrin assembly protein complex 1 sigma 1A small chain; clathrin coat assembly protein AP19; clathrin associated/assembly/adaptor protein; small 1 (19kD); golgi adaptor HA1/AP1 adaptin sigma 1A subunit; HA1 19 kDa subunit; SIGMA1A; sigma1A subunit of AP 1 clathrin adaptor complex; sigma1A adaptin; WUGSC:H_DJ0747G18.2; sigma1A-adaptin; sigma-adaptin 1A; sigma 1a subunit of AP-1 clathrin; adaptor protein complex AP-1 sigma-1A subunit; golgi adaptor HA1/AP1 adaptin sigma-1A subunit; sigma1A subunit of AP-1 clathrin adaptor complex; adapter-related protein complex 1 sigma-1A subunit; clathrin assembly protein complex 1 sigma-1A small chain; clathrin-associated/assembly/adaptor protein, small 1 (19kD); FLJ92436;
Gene ID 1174
mRNA Refseq NM_001283
Protein Refseq NP_001274
MIM 603531
UniProt ID P61966

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP1S1 Products

Required fields are marked with *

My Review for All AP1S1 Products

Required fields are marked with *

0
cart-icon