Recombinant Human AP2A1 protein, GST-tagged

Cat.No. : AP2A1-651H
Product Overview : Human AP2A1 partial ORF ( NP_055018, 824 a.a. - 923 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : QVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP2A1 adaptor-related protein complex 2, alpha 1 subunit [ Homo sapiens ]
Official Symbol AP2A1
Synonyms AP2A1; adaptor-related protein complex 2, alpha 1 subunit; ADTAA, CLAPA1; AP-2 complex subunit alpha-1; alpha1-adaptin; alpha-adaptin A; adaptin, alpha A; 100 kDa coated vesicle protein A; adaptor protein complex AP-2 subunit alpha-1; adapter-related protein complex 2 alpha-1 subunit; clathrin assembly protein complex 2 alpha-A large chain; plasma membrane adaptor HA2/AP2 adaptin alpha A subunit; clathrin-associated/assembly/adaptor protein, large, alpha 1; ADTAA; CLAPA1; AP2-ALPHA;
Gene ID 160
mRNA Refseq NM_014203
Protein Refseq NP_055018
MIM 601026
UniProt ID O95782

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP2A1 Products

Required fields are marked with *

My Review for All AP2A1 Products

Required fields are marked with *

0
cart-icon