Recombinant Human AP2A1 protein, GST-tagged
| Cat.No. : | AP2A1-651H |
| Product Overview : | Human AP2A1 partial ORF ( NP_055018, 824 a.a. - 923 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes the alpha 1 adaptin subunit of the adaptor protein 2 (AP-2) complex found in clathrin coated vesicles. The AP-2 complex is a heterotetramer consisting of two large adaptins (alpha or beta), a medium adaptin (mu), and a small adaptin (sigma). The complex is part of the protein coat on the cytoplasmic face of coated vesicles which links clathrin to receptors in vesicles. Alternative splicing of this gene results in two transcript variants encoding two different isoforms. A third transcript variant has been described, but its full length nature has not been determined. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | QVLNIECLRDFLTPPLLSVRFRYGGAPQALTLKLPVTINKFFQPTEMAAQDFFQRWKQLSLPQQEAQKIFKANHPMDAEVTKAKLLGFGSALLDNVDPNP |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AP2A1 adaptor-related protein complex 2, alpha 1 subunit [ Homo sapiens ] |
| Official Symbol | AP2A1 |
| Synonyms | AP2A1; adaptor-related protein complex 2, alpha 1 subunit; ADTAA, CLAPA1; AP-2 complex subunit alpha-1; alpha1-adaptin; alpha-adaptin A; adaptin, alpha A; 100 kDa coated vesicle protein A; adaptor protein complex AP-2 subunit alpha-1; adapter-related protein complex 2 alpha-1 subunit; clathrin assembly protein complex 2 alpha-A large chain; plasma membrane adaptor HA2/AP2 adaptin alpha A subunit; clathrin-associated/assembly/adaptor protein, large, alpha 1; ADTAA; CLAPA1; AP2-ALPHA; |
| Gene ID | 160 |
| mRNA Refseq | NM_014203 |
| Protein Refseq | NP_055018 |
| MIM | 601026 |
| UniProt ID | O95782 |
| ◆ Recombinant Proteins | ||
| AP2A1-185H | Recombinant Human AP2A1 Protein, His-tagged | +Inquiry |
| AP2A1-600M | Recombinant Mouse AP2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ap2a1-3530M | Recombinant Mouse Ap2a1, His-tagged | +Inquiry |
| AP2A1-27357TH | Recombinant Human AP2A1, His-tagged | +Inquiry |
| AP2A1-175R | Recombinant Rhesus Macaque AP2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP2A1 Products
Required fields are marked with *
My Review for All AP2A1 Products
Required fields are marked with *
