Recombinant Human AP2M1 protein, His-tagged
Cat.No. : | AP2M1-2694H |
Product Overview : | Recombinant Human AP2M1 protein(1-108 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-108 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MIGGLFIYNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHVKRSNIWLAAVTKQNVNAAMVFEFLYKMCDVMAAYFGKISEENIKNNFVLI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AP2M1 adaptor-related protein complex 2, mu 1 subunit [ Homo sapiens ] |
Official Symbol | AP2M1 |
Synonyms | AP2M1; adaptor-related protein complex 2, mu 1 subunit; CLAPM1; AP-2 complex subunit mu; AP 2 mu 2 chain; AP50; clathrin adaptor complex AP2; mu subunit; clathrin assembly protein complex 2 medium chain; clathrin coat adaptor protein AP50; clathrin associated/assembly/adaptor protein; medium 1; HA2 50 kDA subunit; mu2; plasma membrane adaptor AP 2 50kDA protein; adaptin-mu2; AP-2 mu chain; AP-2 mu 2 chain; clathrin coat assembly protein AP50; clathrin coat-associated protein AP50; adaptor protein complex AP-2 subunit mu; clathrin adaptor complex AP2, mu subunit; plasma membrane adaptor AP-2 50kDA protein; plasma membrane adaptor AP-2 50 kDa protein; adapter-related protein complex 2 mu subunit; clathrin-associated/assembly/adaptor protein, medium 1; |
Gene ID | 1173 |
mRNA Refseq | NM_001025205 |
Protein Refseq | NP_001020376 |
MIM | 601024 |
UniProt ID | Q96CW1 |
◆ Recombinant Proteins | ||
AP2M1-1741M | Recombinant Mouse AP2M1 Protein | +Inquiry |
AP2M1-70H | Recombinant Human AP2M1, T7-tagged | +Inquiry |
AP2M1-602M | Recombinant Mouse AP2M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AP2M1-701R | Recombinant Rat AP2M1 Protein | +Inquiry |
AP2M1-351H | Recombinant Human AP2M1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AP2M1-8814HCL | Recombinant Human AP2M1 293 Cell Lysate | +Inquiry |
AP2M1-8813HCL | Recombinant Human AP2M1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP2M1 Products
Required fields are marked with *
My Review for All AP2M1 Products
Required fields are marked with *