Recombinant Human AP2S1 protein, GST-tagged
| Cat.No. : | AP2S1-654H |
| Product Overview : | Human AP2S1 full-length ORF ( AAH06337, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Molecular Mass : | 41.36 kDa |
| AA Sequence : | MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AP2S1 adaptor-related protein complex 2, sigma 1 subunit [ Homo sapiens ] |
| Official Symbol | AP2S1 |
| Synonyms | AP2S1; adaptor-related protein complex 2, sigma 1 subunit; CLAPS2; AP-2 complex subunit sigma; sigma2-adaptin; HA2 17 kDa subunit; clathrin coat assembly protein AP17; clathrin coat-associated protein AP17; clathrin assembly protein 2 small chain; adaptor protein complex AP-2 subunit sigma; plasma membrane adaptor AP-2 17 kDa protein; adapter-related protein complex 2 sigma subunit; clathrin-associated/assembly/adaptor protein, small 2 (17kD); AP17; AP17-DELTA; |
| Gene ID | 1175 |
| mRNA Refseq | NM_004069 |
| Protein Refseq | NP_004060 |
| MIM | 602242 |
| UniProt ID | P53680 |
| ◆ Recombinant Proteins | ||
| AP2S1-187H | Recombinant Human AP2S1 Protein, His-tagged | +Inquiry |
| AP2S1-177R | Recombinant Rhesus Macaque AP2S1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AP2S1-1040HF | Recombinant Full Length Human AP2S1 Protein, GST-tagged | +Inquiry |
| AP2S1-349R | Recombinant Rhesus monkey AP2S1 Protein, His-tagged | +Inquiry |
| AP2S1-3537H | Recombinant Human AP2S1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AP2S1-8811HCL | Recombinant Human AP2S1 293 Cell Lysate | +Inquiry |
| AP2S1-8812HCL | Recombinant Human AP2S1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AP2S1 Products
Required fields are marked with *
My Review for All AP2S1 Products
Required fields are marked with *
