"AP2S1" Related Products

Expand
Expand

Recombinant Human AP2S1 protein, GST-tagged

Cat.No.: AP2S1-654H
Product Overview: Human AP2S1 full-length ORF ( AAH06337, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
Description: One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 41.36 kDa
AA Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: AP2S1 adaptor-related protein complex 2, sigma 1 subunit [ Homo sapiens ]
Official Symbol: AP2S1
Synonyms: AP2S1; adaptor-related protein complex 2, sigma 1 subunit; CLAPS2; AP-2 complex subunit sigma; sigma2-adaptin; HA2 17 kDa subunit; clathrin coat assembly protein AP17; clathrin coat-associated protein AP17; clathrin assembly protein 2 small chain; adaptor protein complex AP-2 subunit sigma; plasma membrane adaptor AP-2 17 kDa protein; adapter-related protein complex 2 sigma subunit; clathrin-associated/assembly/adaptor protein, small 2 (17kD); AP17; AP17-DELTA;
Gene ID: 1175
mRNA Refseq: NM_004069
Protein Refseq: NP_004060
MIM: 602242
UniProt ID: P53680

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.