Recombinant Human AP2S1 protein, GST-tagged

Cat.No. : AP2S1-654H
Product Overview : Human AP2S1 full-length ORF ( AAH06337, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 41.36 kDa
AA Sequence : MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AP2S1 adaptor-related protein complex 2, sigma 1 subunit [ Homo sapiens ]
Official Symbol AP2S1
Synonyms AP2S1; adaptor-related protein complex 2, sigma 1 subunit; CLAPS2; AP-2 complex subunit sigma; sigma2-adaptin; HA2 17 kDa subunit; clathrin coat assembly protein AP17; clathrin coat-associated protein AP17; clathrin assembly protein 2 small chain; adaptor protein complex AP-2 subunit sigma; plasma membrane adaptor AP-2 17 kDa protein; adapter-related protein complex 2 sigma subunit; clathrin-associated/assembly/adaptor protein, small 2 (17kD); AP17; AP17-DELTA;
Gene ID 1175
mRNA Refseq NM_004069
Protein Refseq NP_004060
MIM 602242
UniProt ID P53680

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AP2S1 Products

Required fields are marked with *

My Review for All AP2S1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon