Recombinant Human APOB Protein (28-127 aa), His-tagged
Cat.No. : | APOB-1813H |
Product Overview : | Recombinant Human APOB Protein (28-127 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 28-127 aa |
Description : | Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.2 kDa |
AA Sequence : | EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | APOB apolipoprotein B (including Ag(x) antigen) [ Homo sapiens ] |
Official Symbol | APOB |
Synonyms | APOB; apolipoprotein B-100; apoB-48; apoB-100; apo B-100; mutant Apo B 100; apolipoprotein B48; FLDB; LDLCQ4; |
Gene ID | 338 |
mRNA Refseq | NM_000384 |
Protein Refseq | NP_000375 |
UniProt ID | P04114 |
◆ Recombinant Proteins | ||
APOB-0604H | Recombinant Human APOB Protein (Ile3374-Val3600), N-His-tagged | +Inquiry |
APOB-2535H | Recombinant Human APOB protein, His-tagged | +Inquiry |
Apob-494M | Recombinant Mouse Apob Protein, His-SUMO-tagged | +Inquiry |
APOB-1784M | Recombinant Mouse APOB Protein | +Inquiry |
APOB-1813H | Recombinant Human APOB Protein (28-127 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
APOB-26875TH | Native Human APOB | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
APOB-1H | Native Human Apolipoprotein B | +Inquiry |
APOB-8037H | Native Human Plasma APOB | +Inquiry |
ApoB-3556H | Native Human ApoB | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOB Products
Required fields are marked with *
My Review for All APOB Products
Required fields are marked with *
0
Inquiry Basket