Recombinant Human APOBEC2 protein, GST-tagged

• Cat.No.: APOBEC2-696H
• Product Overview: Human APOBEC2 full-length ORF ( NP_006780.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: APOBEC2 (Apolipoprotein B MRNA Editing Enzyme Catalytic Subunit 2) is a Protein Coding gene. Among its related pathways are mRNA Editing- C to U Conversion and Gene Expression. GO annotations related to this gene include RNA binding and cytidine deaminase activity. An important paralog of this gene is APOBEC3B.
• Molecular Mass: 52.1 kDa
• AA Sequence: MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APOBEC2 apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 [ Homo sapiens ]
• Official Symbol: APOBEC2
• Synonyms: APOBEC2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2; probable C->U-editing enzyme APOBEC-2; ARCD1; ARP1; probable C-> U-editing enzyme APOBEC-2; apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2
• Gene ID: 10930
• mRNA Refseq: NM_006789
• Protein Refseq: NP_006780
• MIM: 604797
• UniProt ID: Q9Y235