Recombinant Human APOC3 protein, GST-tagged

Cat.No. : APOC3-706H
Product Overview : Human APOC3 full-length ORF (AAH27977.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.29 kDa
AA Sequence : MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name APOC3 apolipoprotein C-III [ Homo sapiens ]
Official Symbol APOC3
Synonyms APOC3; apolipoprotein C-III; apo-CIII; apoC-III; apolipoprotein C3; HALP2; APOCIII; MGC150353;
Gene ID 345
mRNA Refseq NM_000040
Protein Refseq NP_000031
MIM 107720
UniProt ID P02656

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All APOC3 Products

Required fields are marked with *

My Review for All APOC3 Products

Required fields are marked with *

0
cart-icon
0
compare icon