Recombinant Human APOC3 protein, GST-tagged
Cat.No. : | APOC3-706H |
Product Overview : | Human APOC3 full-length ORF (AAH27977.1, 1 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Apolipoprotein C-III is a very low density lipoprotein (VLDL) protein. APOC3 inhibits lipoprotein lipase and hepatic lipase; it is thought to delay catabolism of triglyceride-rich particles. The APOA1, APOC3 and APOA4 genes are closely linked in both rat and human genomes. The A-I and A-IV genes are transcribed from the same strand, while the A-1 and C-III genes are convergently transcribed. An increase in apoC-III levels induces the development of hypertriglyceridemia. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | APOC3 apolipoprotein C-III [ Homo sapiens ] |
Official Symbol | APOC3 |
Synonyms | APOC3; apolipoprotein C-III; apo-CIII; apoC-III; apolipoprotein C3; HALP2; APOCIII; MGC150353; |
Gene ID | 345 |
mRNA Refseq | NM_000040 |
Protein Refseq | NP_000031 |
MIM | 107720 |
UniProt ID | P02656 |
◆ Recombinant Proteins | ||
APOC3-706H | Recombinant Human APOC3 protein, GST-tagged | +Inquiry |
APOC3-2198C | Recombinant Cynomolgus monkey APOC3 protein, MBP&His-tagged | +Inquiry |
APOC3-2235C | Recombinant Cynomolgus Monkey APOC3 Protein (21-99 aa), His-SUMOSTAR-tagged | +Inquiry |
Apoc3-1939M | Recombinant Mouse Apoc3 protein, His-tagged | +Inquiry |
APOC3-1789M | Recombinant Mouse APOC3 Protein | +Inquiry |
◆ Native Proteins | ||
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
APOC3-669H | Native Human APOC3 protein | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOC3 Products
Required fields are marked with *
My Review for All APOC3 Products
Required fields are marked with *
0
Inquiry Basket