Recombinant Human APOC3 protein, His-SUMO-tagged
Cat.No. : | APOC3-2539H |
Product Overview : | Recombinant Human APOC3 protein(P02656)(21-99aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-99aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APOC3 apolipoprotein C-III [ Homo sapiens ] |
Official Symbol | APOC3 |
Synonyms | APOC3; apolipoprotein C-III; apo-CIII; apoC-III; apolipoprotein C3; HALP2; APOCIII; MGC150353; |
Gene ID | 345 |
mRNA Refseq | NM_000040 |
Protein Refseq | NP_000031 |
MIM | 107720 |
UniProt ID | P02656 |
◆ Recombinant Proteins | ||
APOC3-1128HF | Recombinant Full Length Human APOC3 Protein, GST-tagged | +Inquiry |
APOC3-0637H | Recombinant Human APOC3 Protein (Ser21-Ala99), N-SUMO-tagged | +Inquiry |
Apoc3-818M | Recombinant Mouse Apoc3 Protein, MYC/DDK-tagged | +Inquiry |
APOC3-393H | Recombinant Human APOC3 protein, His/GST-tagged | +Inquiry |
APOC3-362H | Recombinant Human APOC3 protein | +Inquiry |
◆ Native Proteins | ||
APOC3-27333TH | Native Human APOC3 | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
APOC3-669H | Native Human APOC3 protein | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC3 Products
Required fields are marked with *
My Review for All APOC3 Products
Required fields are marked with *