Recombinant Human APOC4 protein, His-B2M-tagged
Cat.No. : | APOC4-2540H |
Product Overview : | Recombinant Human APOC4 protein(P55056)(27-127aa), fused to N-terminal His tag and B2M tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | B2M&His |
Protein Length : | 27-127aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 25.8 |
AA Sequence : | CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | APOC4 apolipoprotein C-IV [ Homo sapiens ] |
Official Symbol | APOC4 |
Synonyms | APOC4; apolipoprotein C-IV; apolipoprotein C4; APO-CIV; APOC-IV; |
Gene ID | 346 |
mRNA Refseq | NM_001646 |
Protein Refseq | NP_001637 |
MIM | 600745 |
UniProt ID | P55056 |
◆ Recombinant Proteins | ||
APOC4-1790M | Recombinant Mouse APOC4 Protein | +Inquiry |
Apoc4-1855M | Recombinant Mouse Apoc4 protein, His & GST-tagged | +Inquiry |
APOC4-2540H | Recombinant Human APOC4 protein, His-B2M-tagged | +Inquiry |
APOC4-281H | Recombinant Human APOC4, GST-tagged | +Inquiry |
APOC4-1334H | Recombinant Human APOC4 Protein (27-127 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC4-10HFL | Recombinant Human APOC4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC4 Products
Required fields are marked with *
My Review for All APOC4 Products
Required fields are marked with *