Recombinant Human APOLD1 Full Length Transmembrane protein, His-tagged

• Cat.No.: APOLD1-1536H
• Product Overview: Recombinant Human APOLD1 protein(Q96LR9)(1-279aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-279aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.4 kDa
• AA Sequence: MFRAPCHRLRARGTRKARAGAWRGCTFPCLGKGMERPAAREPHGPDALRRFQGLLLDRRGRLHGQVLRLREVARRLERLRRRSLVANVAGSSLSATGALAAIVGLSLSPVTLGTSLLVSAVGLGVATAGGAVTITSDLSLIFCNSRELRRVQEIAATCQDQMREILSCLEFFCRWQGCGDRQLLQCGRNASIALYNSVYFIVFFGSRGFLIPRRAEGDTKVSQAVLKAKIQKLAESLESCTGALDELSEQLESRVQLCTKSSRGHDLKISADQRAGLFF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: APOLD1 apolipoprotein L domain containing 1 [ Homo sapiens ]
• Official Symbol: APOLD1
• Synonyms: APOLD1; apolipoprotein L domain containing 1; apolipoprotein L domain-containing protein 1; DKFZP434F0318; FLJ25138; vascular early response gene protein; VERGE; FLJ95166; DKFZp434F0318
• Gene ID: 81575
• mRNA Refseq: NM_001130415
• Protein Refseq: NP_001123887
• MIM: 612456
• UniProt ID: Q96LR9