Recombinant Human ARAF protein, GST-tagged

Cat.No. : ARAF-187H
Product Overview : Recombinant Human ARAF(225 - 324 aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 225-324 a.a.
Description : This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : STTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGY RDSGYYWEVPPSEVQLLKRIGTGSF
Storage : Aliquot and store at -20 centigrade to -80 centigradefor up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigradeto -80 centigrade.
Gene Name ARAF v-raf murine sarcoma 3611 viral oncogene homolog [ Homo sapiens ]
Official Symbol ARAF
Synonyms ARAF; v-raf murine sarcoma 3611 viral oncogene homolog; ARAF1, v raf murine sarcoma 3611 viral oncogene homolog 1; serine/threonine-protein kinase A-Raf; Oncogene ARAF1; proto-oncogene Pks; proto-oncogene A-Raf-1; Ras-binding protein DA-Raf; v-raf murine sarcoma 3611 viral oncogene homolog 1; A-Raf proto-oncogene serine/threonine-protein kinase; PKS2; A-RAF; ARAF1; RAFA1;
Gene ID 369
mRNA Refseq NM_001256196
Protein Refseq NP_001243125
MIM 311010
UniProt ID P10398
Chromosome Location Xp11.3-p11.23
Pathway Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Colorectal cancer, organism-specific biosystem;
Function ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor signaling protein activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARAF Products

Required fields are marked with *

My Review for All ARAF Products

Required fields are marked with *

0
cart-icon
0
compare icon