Recombinant Human ARAF protein, GST-tagged
| Cat.No. : | ARAF-187H |
| Product Overview : | Recombinant Human ARAF(225 - 324 aa) fused with GST tag at N-terminal was expressed in E. coli. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 225-324 a.a. |
| Description : | This proto-oncogene belongs to the RAF subfamily of the Ser/Thr protein kinase family, and maybe involved in cell growth and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol. |
| AA Sequence : | STTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGY RDSGYYWEVPPSEVQLLKRIGTGSF |
| Storage : | Aliquot and store at -20 centigrade to -80 centigradefor up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigradeto -80 centigrade. |
| Gene Name | ARAF v-raf murine sarcoma 3611 viral oncogene homolog [ Homo sapiens ] |
| Official Symbol | ARAF |
| Synonyms | ARAF; v-raf murine sarcoma 3611 viral oncogene homolog; ARAF1, v raf murine sarcoma 3611 viral oncogene homolog 1; serine/threonine-protein kinase A-Raf; Oncogene ARAF1; proto-oncogene Pks; proto-oncogene A-Raf-1; Ras-binding protein DA-Raf; v-raf murine sarcoma 3611 viral oncogene homolog 1; A-Raf proto-oncogene serine/threonine-protein kinase; PKS2; A-RAF; ARAF1; RAFA1; |
| Gene ID | 369 |
| mRNA Refseq | NM_001256196 |
| Protein Refseq | NP_001243125 |
| MIM | 311010 |
| UniProt ID | P10398 |
| Chromosome Location | Xp11.3-p11.23 |
| Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; Colorectal cancer, organism-specific biosystem; |
| Function | ATP binding; metal ion binding; nucleotide binding; protein binding; protein kinase activity; protein serine/threonine kinase activity; protein serine/threonine kinase activity; receptor signaling protein activity; |
| ◆ Recombinant Proteins | ||
| ARAF-187H | Recombinant Human ARAF protein, GST-tagged | +Inquiry |
| ARAF-3790H | Recombinant Human ARAF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ARAF-7139HFL | Recombinant Full Length Human ARAF protein, Flag-tagged | +Inquiry |
| ARAF-738H | Recombinant Human ARAF protein, GST-tagged | +Inquiry |
| ARAF-185H | Recombinant Human ARAF protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARAF-105HCL | Recombinant Human ARAF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARAF Products
Required fields are marked with *
My Review for All ARAF Products
Required fields are marked with *
