Recombinant Human ARF4 protein, His-tagged
Cat.No. : | ARF4-3956H |
Product Overview : | Recombinant Human ARF4 protein(1-180 aa), fused to His tag, was expressed in E. coli. |
Availability | June 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARF4 ADP-ribosylation factor 4 [ Homo sapiens ] |
Official Symbol | ARF4 |
Synonyms | ARF4; ADP-ribosylation factor 4; ADP ribosylation factor 2 , ARF2; ADP-ribosylation factor 2; ARF2; |
Gene ID | 378 |
mRNA Refseq | NM_001660 |
Protein Refseq | NP_001651 |
MIM | 601177 |
UniProt ID | P18085 |
◆ Recombinant Proteins | ||
ARF4-746H | Recombinant Human ARF4 protein, GST-tagged | +Inquiry |
ARF4-406R | Recombinant Rat ARF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARF4-3956H | Recombinant Human ARF4 protein, His-tagged | +Inquiry |
Arf4-636M | Recombinant Mouse Arf4 Protein, MYC/DDK-tagged | +Inquiry |
ARF4-660M | Recombinant Mouse ARF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARF4-8758HCL | Recombinant Human ARF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARF4 Products
Required fields are marked with *
My Review for All ARF4 Products
Required fields are marked with *
0
Inquiry Basket