Recombinant Human ARHGDIB Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARHGDIB-3480H
Product Overview : ARHGDIB MS Standard C13 and N15-labeled recombinant protein (NP_001166) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Members of the Rho (or ARH) protein family and other Ras-related small GTP-binding proteins are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases.
Molecular Mass : 23 kDa
AA Sequence : MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARHGDIB Rho GDP dissociation inhibitor beta [ Homo sapiens (human) ]
Official Symbol ARHGDIB
Synonyms ARHGDIB; Rho GDP dissociation inhibitor (GDI) beta; GDIA2, GDID4, RAP1GN1; rho GDP-dissociation inhibitor 2; Ly GDI; RhoGDI2; Rho GDI 2; rho-GDI beta; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1;
Gene ID 397
mRNA Refseq NM_001175
Protein Refseq NP_001166
MIM 602843
UniProt ID P52566

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGDIB Products

Required fields are marked with *

My Review for All ARHGDIB Products

Required fields are marked with *

0
cart-icon
0
compare icon