Recombinant Human ARHGDIB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARHGDIB-3480H |
Product Overview : | ARHGDIB MS Standard C13 and N15-labeled recombinant protein (NP_001166) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Members of the Rho (or ARH) protein family and other Ras-related small GTP-binding proteins are involved in diverse cellular events, including cell signaling, proliferation, cytoskeletal organization, and secretion. The GTP-binding proteins are active only in the GTP-bound state. At least 3 classes of proteins tightly regulate cycling between the GTP-bound and GDP-bound states: GTPase-activating proteins (GAPs), guanine nucleotide-releasing factors (GRFs), and GDP-dissociation inhibitors (GDIs). The GDIs, including ARHGDIB, decrease the rate of GDP dissociation from Ras-like GTPases. |
Molecular Mass : | 23 kDa |
AA Sequence : | MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARHGDIB Rho GDP dissociation inhibitor beta [ Homo sapiens (human) ] |
Official Symbol | ARHGDIB |
Synonyms | ARHGDIB; Rho GDP dissociation inhibitor (GDI) beta; GDIA2, GDID4, RAP1GN1; rho GDP-dissociation inhibitor 2; Ly GDI; RhoGDI2; Rho GDI 2; rho-GDI beta; D4; GDIA2; GDID4; LYGDI; Ly-GDI; RAP1GN1; |
Gene ID | 397 |
mRNA Refseq | NM_001175 |
Protein Refseq | NP_001166 |
MIM | 602843 |
UniProt ID | P52566 |
◆ Recombinant Proteins | ||
ARHGDIB-3480H | Recombinant Human ARHGDIB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARHGDIB-1188HF | Recombinant Full Length Human ARHGDIB Protein, GST-tagged | +Inquiry |
ARHGDIB-1277H | Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta | +Inquiry |
ARHGDIB-775H | Recombinant Human ARHGDIB protein, GST-tagged | +Inquiry |
ARHGDIB-3500H | Recombinant Human ARHGDIB protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIB-8735HCL | Recombinant Human ARHGDIB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGDIB Products
Required fields are marked with *
My Review for All ARHGDIB Products
Required fields are marked with *
0
Inquiry Basket