Recombinant Human ARHGEF10 protein, GST-tagged

Cat.No. : ARHGEF10-779H
Product Overview : Human ARHGEF10 partial ORF ( NP_055444, 792 a.a. - 890 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a Rho guanine nucleotide exchange factor (GEF). Rho GEFs regulate the activity of small Rho GTPases by stimulating the exchange of guanine diphosphate (GDP) for guanine triphosphate (GTP) and may play a role in neural morphogenesis. Mutations in this gene are associated with slowed nerve conduction velocity (SNCV). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
Molecular Mass : 36.63 kDa
AA Sequence : GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGEF10 Rho guanine nucleotide exchange factor (GEF) 10 [ Homo sapiens ]
Official Symbol ARHGEF10
Synonyms ARHGEF10; Rho guanine nucleotide exchange factor (GEF) 10; rho guanine nucleotide exchange factor 10; Gef10; KIAA0294; GEF10; MGC131664; DKFZp686H0726;
Gene ID 9639
mRNA Refseq NM_014629
Protein Refseq NP_055444
MIM 608136
UniProt ID O15013

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF10 Products

Required fields are marked with *

My Review for All ARHGEF10 Products

Required fields are marked with *

0
cart-icon
0
compare icon