Recombinant Human ARHGEF10 protein, GST-tagged
| Cat.No. : | ARHGEF10-779H |
| Product Overview : | Human ARHGEF10 partial ORF ( NP_055444, 792 a.a. - 890 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a Rho guanine nucleotide exchange factor (GEF). Rho GEFs regulate the activity of small Rho GTPases by stimulating the exchange of guanine diphosphate (GDP) for guanine triphosphate (GTP) and may play a role in neural morphogenesis. Mutations in this gene are associated with slowed nerve conduction velocity (SNCV). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ARHGEF10 Rho guanine nucleotide exchange factor (GEF) 10 [ Homo sapiens ] |
| Official Symbol | ARHGEF10 |
| Synonyms | ARHGEF10; Rho guanine nucleotide exchange factor (GEF) 10; rho guanine nucleotide exchange factor 10; Gef10; KIAA0294; GEF10; MGC131664; DKFZp686H0726; |
| Gene ID | 9639 |
| mRNA Refseq | NM_014629 |
| Protein Refseq | NP_055444 |
| MIM | 608136 |
| UniProt ID | O15013 |
| ◆ Recombinant Proteins | ||
| ARHGEF10-1144HF | Recombinant Full Length Human ARHGEF10 Protein, GST-tagged | +Inquiry |
| ARHGEF10-778H | Recombinant Human ARHGEF10 protein, GST-tagged | +Inquiry |
| ARHGEF10-9832H | Recombinant Human ARHGEF10, GST-tagged | +Inquiry |
| ARHGEF10-779H | Recombinant Human ARHGEF10 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGEF10-116HCL | Recombinant Human ARHGEF10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF10 Products
Required fields are marked with *
My Review for All ARHGEF10 Products
Required fields are marked with *
