Recombinant Human ARHGEF12 protein, GST-tagged
Cat.No. : | ARHGEF12-781H |
Product Overview : | Human ARHGEF12 partial ORF ( NP_056128, 817 a.a. - 916 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli working through G protein-coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. This protein has been observed to form a myeloid/lymphoid fusion partner in acute myeloid leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGEF12 Rho guanine nucleotide exchange factor (GEF) 12 [ Homo sapiens ] |
Official Symbol | ARHGEF12 |
Synonyms | ARHGEF12; Rho guanine nucleotide exchange factor (GEF) 12; rho guanine nucleotide exchange factor 12; KIAA0382; LARG; leukemia-associated RhoGEF; leukemia-associated rho guanine nucleotide exchange factor; PRO2792; DKFZp686O2372; |
Gene ID | 23365 |
mRNA Refseq | NM_001198665 |
Protein Refseq | NP_001185594 |
MIM | 604763 |
UniProt ID | Q9NZN5 |
◆ Recombinant Proteins | ||
ARHGEF12-391H | Recombinant Human ARHGEF12 protein, His-tagged | +Inquiry |
ARHGEF12-781H | Recombinant Human ARHGEF12 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF12-8734HCL | Recombinant Human ARHGEF12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF12 Products
Required fields are marked with *
My Review for All ARHGEF12 Products
Required fields are marked with *