Recombinant Human ARHGEF12 protein, GST-tagged

Cat.No. : ARHGEF12-781H
Product Overview : Human ARHGEF12 partial ORF ( NP_056128, 817 a.a. - 916 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli working through G protein-coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. This protein has been observed to form a myeloid/lymphoid fusion partner in acute myeloid leukemia. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Molecular Mass : 36.74 kDa
AA Sequence : VSREGILSPSELRKIFSNLEDILQLHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGEF12 Rho guanine nucleotide exchange factor (GEF) 12 [ Homo sapiens ]
Official Symbol ARHGEF12
Synonyms ARHGEF12; Rho guanine nucleotide exchange factor (GEF) 12; rho guanine nucleotide exchange factor 12; KIAA0382; LARG; leukemia-associated RhoGEF; leukemia-associated rho guanine nucleotide exchange factor; PRO2792; DKFZp686O2372;
Gene ID 23365
mRNA Refseq NM_001198665
Protein Refseq NP_001185594
MIM 604763
UniProt ID Q9NZN5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF12 Products

Required fields are marked with *

My Review for All ARHGEF12 Products

Required fields are marked with *

0
cart-icon
0
compare icon