Recombinant Human ARHGEF12 protein, His-tagged

Cat.No. : ARHGEF12-391H
Product Overview : Recombinant Human ARHGEF12 protein(Q9NZN5)(367-558aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 367-558aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 28.7 kDa
AA Sequence : GQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name ARHGEF12 Rho guanine nucleotide exchange factor (GEF) 12 [ Homo sapiens ]
Official Symbol ARHGEF12
Synonyms ARHGEF12; Rho guanine nucleotide exchange factor (GEF) 12; rho guanine nucleotide exchange factor 12; KIAA0382; LARG; leukemia-associated RhoGEF; leukemia-associated rho guanine nucleotide exchange factor; PRO2792; DKFZp686O2372;
Gene ID 23365
mRNA Refseq NM_001198665
Protein Refseq NP_001185594
MIM 604763
UniProt ID Q9NZN5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF12 Products

Required fields are marked with *

My Review for All ARHGEF12 Products

Required fields are marked with *

0
cart-icon