Recombinant Human ARHGEF12 protein, His-tagged
Cat.No. : | ARHGEF12-391H |
Product Overview : | Recombinant Human ARHGEF12 protein(Q9NZN5)(367-558aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 367-558aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 28.7 kDa |
AA Sequence : | GQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIFLEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLEDFRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARHGEF12 Rho guanine nucleotide exchange factor (GEF) 12 [ Homo sapiens ] |
Official Symbol | ARHGEF12 |
Synonyms | ARHGEF12; Rho guanine nucleotide exchange factor (GEF) 12; rho guanine nucleotide exchange factor 12; KIAA0382; LARG; leukemia-associated RhoGEF; leukemia-associated rho guanine nucleotide exchange factor; PRO2792; DKFZp686O2372; |
Gene ID | 23365 |
mRNA Refseq | NM_001198665 |
Protein Refseq | NP_001185594 |
MIM | 604763 |
UniProt ID | Q9NZN5 |
◆ Recombinant Proteins | ||
ARHGEF12-391H | Recombinant Human ARHGEF12 protein, His-tagged | +Inquiry |
ARHGEF12-781H | Recombinant Human ARHGEF12 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF12-8734HCL | Recombinant Human ARHGEF12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF12 Products
Required fields are marked with *
My Review for All ARHGEF12 Products
Required fields are marked with *