Recombinant Human ARHGEF2 Protein, N-GST-tagged
| Cat.No. : | ARHGEF2-03H |
| Product Overview : | Recombinant Human ARHGEF2 Protein, fused to GST-tag at N-terminus, was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 860-959 aa |
| Description : | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | LPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ARHGEF2 Rho/Rac guanine nucleotide exchange factor 2 [ Homo sapiens (human) ] |
| Official Symbol | ARHGEF2 |
| Synonyms | GEF; Lfc; P40; GEFH1; LFP40; GEF-H1; NEDMHM; Rho/Rac guanine nucleotide exchange factor 2; DKFZp547L106; DKFZp547P1516; KIAA0651; P40; ARHGEF2 |
| Gene ID | 9181 |
| mRNA Refseq | NM_004723.4 |
| Protein Refseq | NP_004714.2 |
| MIM | 607560 |
| UniProt ID | Q92974 |
| ◆ Recombinant Proteins | ||
| ARHGEF2-04H | Recombinant Human ARHGEF2 Protein, N-GST-tagged | +Inquiry |
| ARHGEF2-05M | Recombinant Mouse ARHGEF2 Protein, C-Flag-tagged | +Inquiry |
| ARHGEF2-426R | Recombinant Rat ARHGEF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARHGEF2-770R | Recombinant Rat ARHGEF2 Protein | +Inquiry |
| ARHGEF2-03H | Recombinant Human ARHGEF2 Protein, N-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARHGEF2-052HKCL | Human ARHGEF2 Knockdown Cell Lysate | +Inquiry |
| ARHGEF2-8732HCL | Recombinant Human ARHGEF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF2 Products
Required fields are marked with *
My Review for All ARHGEF2 Products
Required fields are marked with *
