Recombinant Human ARHGEF2 Protein, N-GST-tagged

• Cat.No.: ARHGEF2-03H
• Product Overview: Recombinant Human ARHGEF2 Protein, fused to GST-tag at N-terminus, was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 860-959 aa
• Description: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: LPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ARHGEF2 Rho/Rac guanine nucleotide exchange factor 2 [ Homo sapiens (human) ]
• Official Symbol: ARHGEF2
• Synonyms: GEF; Lfc; P40; GEFH1; LFP40; GEF-H1; NEDMHM; Rho/Rac guanine nucleotide exchange factor 2; DKFZp547L106; DKFZp547P1516; KIAA0651; P40; ARHGEF2
• Gene ID: 9181
• mRNA Refseq: NM_004723.4
• Protein Refseq: NP_004714.2
• MIM: 607560
• UniProt ID: Q92974