Recombinant Human ARHGEF2 Protein, N-GST-tagged
Cat.No. : | ARHGEF2-03H |
Product Overview : | Recombinant Human ARHGEF2 Protein, fused to GST-tag at N-terminus, was expressed in Wheat Germ (in vitro). |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 860-959 aa |
Description : | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | LPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ARHGEF2 Rho/Rac guanine nucleotide exchange factor 2 [ Homo sapiens (human) ] |
Official Symbol | ARHGEF2 |
Synonyms | GEF; Lfc; P40; GEFH1; LFP40; GEF-H1; NEDMHM; Rho/Rac guanine nucleotide exchange factor 2; DKFZp547L106; DKFZp547P1516; KIAA0651; P40; ARHGEF2 |
Gene ID | 9181 |
mRNA Refseq | NM_004723.4 |
Protein Refseq | NP_004714.2 |
MIM | 607560 |
UniProt ID | Q92974 |
◆ Recombinant Proteins | ||
Arhgef2-1297M | Recombinant Mouse Arhgef2 Protein, MYC/DDK-tagged | +Inquiry |
ARHGEF2-770R | Recombinant Rat ARHGEF2 Protein | +Inquiry |
ARHGEF2-785H | Recombinant Human ARHGEF2 protein, GST-tagged | +Inquiry |
ARHGEF2-04H | Recombinant Human ARHGEF2 Protein, N-GST-tagged | +Inquiry |
ARHGEF2-03H | Recombinant Human ARHGEF2 Protein, N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF2-8732HCL | Recombinant Human ARHGEF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF2 Products
Required fields are marked with *
My Review for All ARHGEF2 Products
Required fields are marked with *