Recombinant Human ARHGEF2 Protein, N-GST-tagged

Cat.No. : ARHGEF2-03H
Product Overview : Recombinant Human ARHGEF2 Protein, fused to GST-tag at N-terminus, was expressed in Wheat Germ (in vitro).
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 860-959 aa
Description : Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate rho-dependent signals. Alternatively spliced transcript variants encoding different isoforms have been identified.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.63 kDa
AA Sequence : LPAGDALYLSFNPPQPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHSPRDFTRMQDIPEETESRDGEAVASES
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ARHGEF2 Rho/Rac guanine nucleotide exchange factor 2 [ Homo sapiens (human) ]
Official Symbol ARHGEF2
Synonyms GEF; Lfc; P40; GEFH1; LFP40; GEF-H1; NEDMHM; Rho/Rac guanine nucleotide exchange factor 2; DKFZp547L106; DKFZp547P1516; KIAA0651; P40; ARHGEF2
Gene ID 9181
mRNA Refseq NM_004723.4
Protein Refseq NP_004714.2
MIM 607560
UniProt ID Q92974

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARHGEF2 Products

Required fields are marked with *

My Review for All ARHGEF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon