Recombinant Human ARID4A protein, GST-tagged

Cat.No. : ARID4A-797H
Product Overview : Human ARID4A partial ORF ( NP_002883, 1033 a.a. - 1139 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.51 kDa
AA Sequence : AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARID4A AT rich interactive domain 4A (RBP1-like) [ Homo sapiens ]
Official Symbol ARID4A
Synonyms ARID4A; AT rich interactive domain 4A (RBP1-like); RBBP1, retinoblastoma binding protein 1; AT-rich interactive domain-containing protein 4A; RBP 1; RBP1; retinoblastoma binding protein 1; retinoblastoma-binding protein 1; ARID domain-containing protein 4A; RBBP1; RBP-1; RBBP-1;
Gene ID 5926
mRNA Refseq NM_002892
Protein Refseq NP_002883
MIM 180201
UniProt ID P29374

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARID4A Products

Required fields are marked with *

My Review for All ARID4A Products

Required fields are marked with *

0
cart-icon