Recombinant Human ARID4A protein, GST-tagged
Cat.No. : | ARID4A-797H |
Product Overview : | Human ARID4A partial ORF ( NP_002883, 1033 a.a. - 1139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein (pRB) which regulates cell proliferation. pRB represses transcription by recruiting the encoded protein. This protein, in turn, serves as a bridging molecule to recruit HDACs and, in addition, provides a second HDAC-independent repression function. The encoded protein possesses transcriptional repression activity. Multiple alternatively spliced transcripts have been observed for this gene, although not all transcript variants have been fully described. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.51 kDa |
AA Sequence : | AEESQEGLCERESANGFETNVASGTCSIIVQERESREKGQKRPSDGNSGLMAKKQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLAR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARID4A AT rich interactive domain 4A (RBP1-like) [ Homo sapiens ] |
Official Symbol | ARID4A |
Synonyms | ARID4A; AT rich interactive domain 4A (RBP1-like); RBBP1, retinoblastoma binding protein 1; AT-rich interactive domain-containing protein 4A; RBP 1; RBP1; retinoblastoma binding protein 1; retinoblastoma-binding protein 1; ARID domain-containing protein 4A; RBBP1; RBP-1; RBBP-1; |
Gene ID | 5926 |
mRNA Refseq | NM_002892 |
Protein Refseq | NP_002883 |
MIM | 180201 |
UniProt ID | P29374 |
◆ Recombinant Proteins | ||
ARID4A-3680H | Recombinant Human ARID4A, His-tagged | +Inquiry |
ARID4A-797H | Recombinant Human ARID4A protein, GST-tagged | +Inquiry |
ARID4A-3363Z | Recombinant Zebrafish ARID4A | +Inquiry |
ARID4A-2117C | Recombinant Chicken ARID4A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARID4A Products
Required fields are marked with *
My Review for All ARID4A Products
Required fields are marked with *
0
Inquiry Basket