Recombinant Human ARID4B protein, His-tagged
| Cat.No. : | ARID4B-4497H |
| Product Overview : | Recombinant Human ARID4B protein(Q4LE39)(167-415aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 167-415aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.8 kDa |
| AA Sequence : | KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | ARID4B AT rich interactive domain 4B (RBP1-like) [ Homo sapiens ] |
| Official Symbol | ARID4B |
| Synonyms | ARID4B; AT rich interactive domain 4B (RBP1-like); AT rich interactive domain 4B (RBP1 like) , RBP1L1, retinoblastoma binding protein 1 like 1; AT-rich interactive domain-containing protein 4B; BCAA; BRCAA1; SAP180; Rb-binding protein homolog; SIN3A-associated protein 180; sin3-associated polypeptide p180; ARID domain-containing protein 4B; breast cancer-associated antigen 1; 180 kDa Sin3-associated polypeptide; breast carcinoma-associated antigen; breast cancer-associated antigen BRCAA1; retinoblastoma-binding protein 1-like 1; histone deacetylase complex subunit SAP180; RBP1L1; RBBP1L1; MGC163290; DKFZp313M2420; |
| Gene ID | 51742 |
| mRNA Refseq | NM_001206794 |
| Protein Refseq | NP_001193723 |
| MIM | 609696 |
| UniProt ID | Q4LE39 |
| ◆ Recombinant Proteins | ||
| SOLH-27401TH | Recombinant Human SOLH | +Inquiry |
| Arid4b-3681M | Recombinant Mouse Arid4b, His-tagged | +Inquiry |
| SOLH-15754M | Recombinant Mouse SOLH Protein | +Inquiry |
| ARID4B-3658H | Recombinant Human ARID4B protein, GST-tagged | +Inquiry |
| ARID4B-709M | Recombinant Mouse ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARID4B Products
Required fields are marked with *
My Review for All ARID4B Products
Required fields are marked with *
