Recombinant Human ARID4B protein, His-tagged
Cat.No. : | ARID4B-4497H |
Product Overview : | Recombinant Human ARID4B protein(Q4LE39)(167-415aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 167-415aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.8 kDa |
AA Sequence : | KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ARID4B AT rich interactive domain 4B (RBP1-like) [ Homo sapiens ] |
Official Symbol | ARID4B |
Synonyms | ARID4B; AT rich interactive domain 4B (RBP1-like); AT rich interactive domain 4B (RBP1 like) , RBP1L1, retinoblastoma binding protein 1 like 1; AT-rich interactive domain-containing protein 4B; BCAA; BRCAA1; SAP180; Rb-binding protein homolog; SIN3A-associated protein 180; sin3-associated polypeptide p180; ARID domain-containing protein 4B; breast cancer-associated antigen 1; 180 kDa Sin3-associated polypeptide; breast carcinoma-associated antigen; breast cancer-associated antigen BRCAA1; retinoblastoma-binding protein 1-like 1; histone deacetylase complex subunit SAP180; RBP1L1; RBBP1L1; MGC163290; DKFZp313M2420; |
Gene ID | 51742 |
mRNA Refseq | NM_001206794 |
Protein Refseq | NP_001193723 |
MIM | 609696 |
UniProt ID | Q4LE39 |
◆ Recombinant Proteins | ||
ARID4B-1915M | Recombinant Mouse ARID4B Protein | +Inquiry |
ARID4B-709M | Recombinant Mouse ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
Arid4b-3681M | Recombinant Mouse Arid4b, His-tagged | +Inquiry |
ARID4B-4497H | Recombinant Human ARID4B protein, His-tagged | +Inquiry |
SOLH-15754M | Recombinant Mouse SOLH Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARID4B Products
Required fields are marked with *
My Review for All ARID4B Products
Required fields are marked with *
0
Inquiry Basket