Recombinant Human ARL4D protein, His-tagged
| Cat.No. : | ARL4D-9859H |
| Product Overview : | Recombinant Human ARL4D protein(1-201 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-201 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MGNHLTEMAPTASSFLPHFQALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTEKIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGLQQGLERLYEMILKRKKAARGGKKRR |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ARL4D ADP-ribosylation factor-like 4D [ Homo sapiens ] |
| Official Symbol | ARL4D |
| Synonyms | ARL4D; ADP-ribosylation factor-like 4D; ADP ribosylation factor 4 like , ARF4L; ADP-ribosylation factor-like protein 4D; ADP-ribosylation factor-like 6; ADP-ribosylation factor-like protein 4L; ARL6; ARF4L; |
| Gene ID | 379 |
| mRNA Refseq | NM_001661 |
| Protein Refseq | NP_001652 |
| MIM | 600732 |
| UniProt ID | P49703 |
| ◆ Recombinant Proteins | ||
| ARL4D-10045Z | Recombinant Zebrafish ARL4D | +Inquiry |
| ARL4D-1933M | Recombinant Mouse ARL4D Protein | +Inquiry |
| ARL4D-1182HF | Recombinant Full Length Human ARL4D Protein, GST-tagged | +Inquiry |
| ARL4D-813H | Recombinant Human ARL4D protein, GST-tagged | +Inquiry |
| ARL4D-27056TH | Recombinant Human ARL4D, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARL4D-8711HCL | Recombinant Human ARL4D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL4D Products
Required fields are marked with *
My Review for All ARL4D Products
Required fields are marked with *
