Recombinant Human ARL6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ARL6-622H
Product Overview : ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_816931) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246).
Molecular Mass : 21.1 kDa
AA Sequence : MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ARL6 ADP-ribosylation factor-like 6 [ Homo sapiens (human) ]
Official Symbol ARL6
Synonyms ARL6; ADP ribosylation factor like GTPase 6; BBS3; RP55; ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein
Gene ID 84100
mRNA Refseq NM_177976
Protein Refseq NP_816931
MIM 608845
UniProt ID Q9H0F7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL6 Products

Required fields are marked with *

My Review for All ARL6 Products

Required fields are marked with *

0
cart-icon
0
compare icon