Recombinant Human ARL6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ARL6-622H |
Product Overview : | ARL6 MS Standard C13 and N15-labeled recombinant protein (NP_816931) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ARL6 ADP-ribosylation factor-like 6 [ Homo sapiens (human) ] |
Official Symbol | ARL6 |
Synonyms | ARL6; ADP ribosylation factor like GTPase 6; BBS3; RP55; ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein |
Gene ID | 84100 |
mRNA Refseq | NM_177976 |
Protein Refseq | NP_816931 |
MIM | 608845 |
UniProt ID | Q9H0F7 |
◆ Recombinant Proteins | ||
ARL6-726M | Recombinant Mouse ARL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL6-4974H | Recombinant Human ADP-Ribosylation Factor-Like 6, His-tagged | +Inquiry |
ARL6-1937M | Recombinant Mouse ARL6 Protein | +Inquiry |
ARL6-5531H | Recombinant Human ARL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL6-622H | Recombinant Human ARL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL6-8708HCL | Recombinant Human ARL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL6 Products
Required fields are marked with *
My Review for All ARL6 Products
Required fields are marked with *