Recombinant Human ARRDC1-AS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ARRDC1-AS1-1866H
• Product Overview: C9orf37 MS Standard C13 and N15-labeled recombinant protein (NP_116326) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This transcribed locus is thought to be non-coding. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 18 kDa
• AA Sequence: MEFHYVAQADLELLTSSNPPASASQSTGITGGSHRARPGPVHFIDKVTDKPSHSHPFALKENWNLNPEPSSPPSPLFLEAPSRQASQHHGASPGAGTSAGCPFEKCCSTEPCLSGLGDVGRGEAASLRARPGSGASRGQGPGSRVSCRRDLGKPLHAPAGFSAGEVHTTPLGNLGATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ARRDC1-AS1 ARRDC1 antisense RNA 1 [ Homo sapiens (human) ]
• Official Symbol: ARRDC1-AS1
• Synonyms: ARRDC1-AS1; ARRDC1 antisense RNA 1; C9orf37; AD038
• Gene ID: 85026
• mRNA Refseq: NM_032937
• Protein Refseq: NP_116326
• UniProt ID: Q9H2J1