Recombinant Human ASCL1 protein, Arginine-tagged
Cat.No. : | ASCL1-131H |
Product Overview : | Recombinant human ASCL1 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | ESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSG GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAAN KKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEE QELLDFTNWFLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for neuronal cell trans-differentiation in vitro.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days |
Gene Name | ASCL1 achaete-scute complex homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | ASCL1 |
Synonyms | ASCL1; achaete-scute homolog 1; ASH1; bHLHa46; HASH1; ASH-1; achaete scute protein; achaete-scute complex-like 1; class A basic helix-loop-helix protein 46; MASH1; |
Gene ID | 429 |
mRNA Refseq | NM_004316 |
Protein Refseq | NP_004307 |
MIM | 100790 |
UniProt ID | P50553 |
Chromosome Location | 12q22-q23 |
Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; |
Function | DNA binding; E-box binding; bHLH transcription factor binding; double-stranded DNA binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding transcription factor activity; |
◆ Recombinant Proteins | ||
ASCL1-901H | Recombinant Human ASCL1 protein, GST-tagged | +Inquiry |
ASCL1-5982C | Recombinant Chicken ASCL1 | +Inquiry |
ASCL1-754HFL | Recombinant Full Length Human ASCL1 Protein, C-Flag-tagged | +Inquiry |
ASCL1-2025M | Recombinant Mouse ASCL1 Protein | +Inquiry |
ASCL1-818R | Recombinant Rat ASCL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASCL1-8654HCL | Recombinant Human ASCL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL1 Products
Required fields are marked with *
My Review for All ASCL1 Products
Required fields are marked with *