"ASCL1" Related Products

Expand
Expand
Expand

Recombinant Human ASCL1 protein, Arginine-tagged

Cat.No.: ASCL1-131H
Product Overview: Recombinant human ASCL1 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: ESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAADGQPSG GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNGAAN KKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEE QELLDFTNWFLEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for neuronal cell trans-differentiation in vitro.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name: ASCL1 achaete-scute complex homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol: ASCL1
Synonyms: ASCL1; achaete-scute homolog 1; ASH1; bHLHa46; HASH1; ASH-1; achaete scute protein; achaete-scute complex-like 1; class A basic helix-loop-helix protein 46; MASH1;
Gene ID: 429
mRNA Refseq: NM_004316
Protein Refseq: NP_004307
MIM: 100790
UniProt ID: P50553
Chromosome Location: 12q22-q23
Pathway: Delta-Notch Signaling Pathway, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem;
Function: DNA binding; E-box binding; bHLH transcription factor binding; double-stranded DNA binding; protein binding; protein homodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription factor binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.