Recombinant Human ASCL2 protein, GST-tagged
Cat.No. : | ASCL2-905H |
Product Overview : | Recombinant Human ASCL2(1 a.a. - 193 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 193 a.a. |
Description : | This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 46.6 kDa |
AA Sequence : | MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | ASCL2 achaete-scute complex homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | ASCL2 |
Synonyms | ASCL2; achaete-scute complex homolog 2 (Drosophila); achaete scute complex (Drosophila) homolog like 2 , achaete scute complex like 2 (Drosophila); achaete-scute homolog 2; ASH2; bHLHa45; HASH2; ASH-2; achaete-scute complex-like 2; mammalian achaete/scute homologue 2; class A basic helix-loop-helix protein 45; MASH2; |
Gene ID | 430 |
mRNA Refseq | NM_005170 |
Protein Refseq | NP_005161 |
MIM | 601886 |
UniProt ID | Q99929 |
◆ Recombinant Proteins | ||
ASCL2-785M | Recombinant Mouse ASCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASCL2-906H | Recombinant Human SILV protein, MYC/DDK-tagged | +Inquiry |
ASCL2-387H | Recombinant Human ASCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASCL2-475R | Recombinant Rat ASCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASCL2-9926H | Recombinant Human ASCL2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASCL2 Products
Required fields are marked with *
My Review for All ASCL2 Products
Required fields are marked with *