Recombinant Human ASCL2 protein, GST-tagged

Cat.No. : ASCL2-905H
Product Overview : Recombinant Human ASCL2(1 a.a. - 193 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 193 a.a.
Description : This gene is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. Involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 46.6 kDa
AA Sequence : MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ASCL2 achaete-scute complex homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol ASCL2
Synonyms ASCL2; achaete-scute complex homolog 2 (Drosophila); achaete scute complex (Drosophila) homolog like 2 , achaete scute complex like 2 (Drosophila); achaete-scute homolog 2; ASH2; bHLHa45; HASH2; ASH-2; achaete-scute complex-like 2; mammalian achaete/scute homologue 2; class A basic helix-loop-helix protein 45; MASH2;
Gene ID 430
mRNA Refseq NM_005170
Protein Refseq NP_005161
MIM 601886
UniProt ID Q99929

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASCL2 Products

Required fields are marked with *

My Review for All ASCL2 Products

Required fields are marked with *

0
cart-icon