Recombinant Human ASTN1, His-tagged
| Cat.No. : | ASTN1-9941H |
| Product Overview : | Recombinant Human ASTN1(O14525)(Gly211-Thr360), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Gly211-Thr360 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 18 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GHGRESLRNARVQGHNSSGTLSIRETPILDGYEYDITDLRHHLQRECMNGGEDFASQVTRTLDSLQGCNEKSGMDLTPGSDNAKLSLMNKYKDNIIATSPVDSNHQQATLLSHTSSSQRKRINNKARAGSAFLNPEGDSGTEAENDPQLT |
| Gene Name | ASTN1 astrotactin 1 [ Homo sapiens ] |
| Official Symbol | ASTN1 |
| Synonyms | ASTN; Astrotactin 1; ASTROTACTIN; ASTN1; KIAA0289 |
| Gene ID | 460 |
| mRNA Refseq | NM_004319.1 |
| Protein Refseq | NP_004310.1 |
| MIM | 600904 |
| UniProt ID | O14525 |
| ◆ Recombinant Proteins | ||
| ASTN1-9940H | Recombinant Human ASTN1, His-tagged | +Inquiry |
| ASTN1-3674H | Recombinant Human ASTN1, His-tagged | +Inquiry |
| ASTN1-9941H | Recombinant Human ASTN1, His-tagged | +Inquiry |
| ASTN1-4560H | Recombinant Human ASTN1 protein, His-tagged | +Inquiry |
| ASTN1-433R | Recombinant Rhesus monkey ASTN1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASTN1 Products
Required fields are marked with *
My Review for All ASTN1 Products
Required fields are marked with *



