Recombinant Human ATG10 protein, GST-tagged

Cat.No. : ATG10-942H
Product Overview : Human ATG10 full-length ORF ( NP_113670.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).[supplied by OMIM, Mar 2008]
Molecular Mass : 51.7 kDa
AA Sequence : MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATG10 ATG10 autophagy related 10 homolog (S. cerevisiae) [ Homo sapiens ]
Official Symbol ATG10
Synonyms ATG10; ATG10 autophagy related 10 homolog (S. cerevisiae); APG10 autophagy 10 like (S. cerevisiae) , APG10L; ubiquitin-like-conjugating enzyme ATG10; DKFZP586I0418; FLJ13954; autophagy-related protein 10; APG10; APG10L; pp12616; DKFZp586I0418;
Gene ID 83734
mRNA Refseq NM_001131028
Protein Refseq NP_001124500
MIM 610800
UniProt ID Q9H0Y0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATG10 Products

Required fields are marked with *

My Review for All ATG10 Products

Required fields are marked with *

0
cart-icon
0
compare icon