Recombinant Human ATG10 protein, GST-tagged
Cat.No. : | ATG10-942H |
Product Overview : | Human ATG10 full-length ORF ( NP_113670.1, 1 a.a. - 220 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Autophagy is a process for the bulk degradation of cytosolic compartments by lysosomes. ATG10 is an E2-like enzyme involved in 2 ubiquitin-like modifications essential for autophagosome formation: ATG12 (MIM 609608)-ATG5 (MIM 604261) conjugation and modification of a soluble form of MAP-LC3 (MAP1LC3A; MIM 601242), a homolog of yeast Apg8, to a membrane-bound form (Nemoto et al., 2003 [PubMed 12890687]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWLSIVGPVVGLNLPLSYAKATSQDERNVP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATG10 ATG10 autophagy related 10 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG10 |
Synonyms | ATG10; ATG10 autophagy related 10 homolog (S. cerevisiae); APG10 autophagy 10 like (S. cerevisiae) , APG10L; ubiquitin-like-conjugating enzyme ATG10; DKFZP586I0418; FLJ13954; autophagy-related protein 10; APG10; APG10L; pp12616; DKFZp586I0418; |
Gene ID | 83734 |
mRNA Refseq | NM_001131028 |
Protein Refseq | NP_001124500 |
MIM | 610800 |
UniProt ID | Q9H0Y0 |
◆ Recombinant Proteins | ||
ATG10-9968H | Recombinant Human ATG10, GST-tagged | +Inquiry |
ATG10-0458H | Recombinant Human ATG10 Protein (Met1-Thr190), N-T7 and C-His-tagged | +Inquiry |
ATG10-7174H | Recombinant Human ATG10 Autophagy Related 10 Homolog (S. cerevisiae), His-tagged | +Inquiry |
Atg10-258R | Recombinant Rat Atg10 Protein, His-tagged | +Inquiry |
Atg10-257M | Recombinant Mouse Atg10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG10-8627HCL | Recombinant Human ATG10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG10 Products
Required fields are marked with *
My Review for All ATG10 Products
Required fields are marked with *
0
Inquiry Basket