Recombinant Human ATG3 protein, His-SUMO-tagged
Cat.No. : | ATG3-2564H |
Product Overview : | Recombinant Human ATG3 protein(Q9NT62)(1-314aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-314aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ATG3 ATG3 autophagy related 3 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | ATG3 |
Synonyms | ATG3; ATG3 autophagy related 3 homolog (S. cerevisiae); APG3 autophagy 3 like (S. cerevisiae) , APG3L; ubiquitin-like-conjugating enzyme ATG3; DKFZp564M1178; FLJ22125; MGC15201; PC3 96; hApg3; 2610016C12Rik; autophagy-related protein 3; APG3; APG3L; PC3-96; APG3-LIKE; |
Gene ID | 64422 |
mRNA Refseq | NM_022488 |
Protein Refseq | NP_071933 |
MIM | 609606 |
UniProt ID | Q9NT62 |
◆ Recombinant Proteins | ||
ATG3-396H | Recombinant Human ATG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATG3-5340C | Recombinant Chicken ATG3 | +Inquiry |
ATG3-35H | Recombinant Human ATG3, His-tagged | +Inquiry |
ATG3-222H | Recombinant Human ATG3, His-tagged | +Inquiry |
APG3L-678H | Recombinant Human APG3L protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG3-8625HCL | Recombinant Human ATG3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATG3 Products
Required fields are marked with *
My Review for All ATG3 Products
Required fields are marked with *
0
Inquiry Basket