Recombinant Human ATP5B, His-tagged
Cat.No. : | ATP5B-26425TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 156-529 of Human ATPB, with N terminal His tag, 374 amino acids, MWt 45kDa, , |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 156-529 a.a. |
Description : | This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 143 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAP YAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVF AGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQ MNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRF TQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTT KKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSR AIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKI LQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLS QPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLP EQAFYMVGPIEEAVAKADKLAEEHSS |
Sequence Similarities : | Belongs to the ATPase alpha/beta chains family. |
Gene Name | ATP5B ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide [ Homo sapiens ] |
Official Symbol | ATP5B |
Synonyms | ATP5B; ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide; ATPSB; ATP synthase subunit beta, mitochondrial; |
Gene ID | 506 |
mRNA Refseq | NM_001686 |
Protein Refseq | NP_001677 |
MIM | 102910 |
Uniprot ID | P06576 |
Chromosome Location | 12p13.3 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; F-type ATPase, eukaryotes, organism-specific biosystem; Formation of ATP by chemiosmotic coupling, organism-specific biosystem; |
Function | ATP binding; contributes_to ATPase activity; MHC class I protein binding; calcium ion binding; eukaryotic cell surface binding; |
◆ Recombinant Proteins | ||
ATP5B-2130M | Recombinant Mouse ATP5B Protein | +Inquiry |
ATP5B-868R | Recombinant Rat ATP5B Protein | +Inquiry |
ATP5B-1137H | Recombinant Human ATP5B Protein, His-tagged | +Inquiry |
ATP5B-346M | Recombinant Mouse ATP5B Protein (47-529 aa), His-SUMO-tagged | +Inquiry |
ATP5B-977H | Recombinant Human ATP5B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5B-8605HCL | Recombinant Human ATP5B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP5B Products
Required fields are marked with *
My Review for All ATP5B Products
Required fields are marked with *
0
Inquiry Basket