Recombinant Human ATP5E protein, GST-tagged

Cat.No. : ATP5E-980H
Product Overview : Human ATP5E full-length ORF ( AAH01690, 1 a.a. - 51 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the epsilon subunit of the catalytic core. Two pseudogenes of this gene are located on chromosomes 4 and 13. Read-through transcripts that include exons from this gene are expressed from the upstream gene SLMO2.[provided by RefSeq, Mar 2011]
Molecular Mass : 31.35 kDa
AA Sequence : MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSNVKIVKVKKE
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP5E ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit [ Homo sapiens ]
Official Symbol ATP5E
Synonyms ATP5E; ATP synthase, H+ transporting, mitochondrial F1 complex, epsilon subunit; ATP synthase subunit epsilon, mitochondrial; F(0)F(1)-ATPase; mitochondrial ATPase; H(+)-transporting two-sector ATPase; mitochondrial ATP synthase epsilon chain; ATPE; MC5DN3; MGC104243;
Gene ID 514
mRNA Refseq NM_006886
Protein Refseq NP_008817
MIM 606153
UniProt ID P56381

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP5E Products

Required fields are marked with *

My Review for All ATP5E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon