Recombinant Human ATP5O protein, GST-tagged
| Cat.No. : | ATP5O-989H |
| Product Overview : | Human ATP5O full-length ORF ( AAH21233, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 49.17 kDa |
| AA Sequence : | MAAPAVSGLSRQVRCLSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ] |
| Official Symbol | ATP5O |
| Synonyms | ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein; |
| Gene ID | 539 |
| mRNA Refseq | NM_001697 |
| Protein Refseq | NP_001688 |
| MIM | 600828 |
| UniProt ID | P48047 |
| ◆ Recombinant Proteins | ||
| ATP5O-868M | Recombinant Mouse ATP5O Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP5O-27062TH | Recombinant Human ATP5O, His-tagged | +Inquiry |
| ATP5O-1543HF | Recombinant Full Length Human ATP5O Protein, GST-tagged | +Inquiry |
| ATP5O-2571H | Recombinant Human ATP5O protein, GST-tagged | +Inquiry |
| ATP5O-1132Z | Recombinant Zebrafish ATP5O | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5O Products
Required fields are marked with *
My Review for All ATP5O Products
Required fields are marked with *
