Recombinant Human ATP5O protein, GST-tagged
Cat.No. : | ATP5O-989H |
Product Overview : | Human ATP5O full-length ORF ( AAH21233, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a component of the F-type ATPase found in the mitochondrial matrix. F-type ATPases are composed of a catalytic core and a membrane proton channel. The encoded protein appears to be part of the connector linking these two components and may be involved in transmission of conformational changes or proton conductance. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.17 kDa |
AA Sequence : | MAAPAVSGLSRQVRCLSTSVVRPFAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP5O ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit [ Homo sapiens ] |
Official Symbol | ATP5O |
Synonyms | ATP5O; ATP synthase, H+ transporting, mitochondrial F1 complex, O subunit; ATP synthase subunit O, mitochondrial; ATPO; oligomycin sensitivity conferring protein; OSCP; human ATP synthase OSCP subunit; oligomycin sensitivity conferral protein; |
Gene ID | 539 |
mRNA Refseq | NM_001697 |
Protein Refseq | NP_001688 |
MIM | 600828 |
UniProt ID | P48047 |
◆ Recombinant Proteins | ||
ATP5O-2571H | Recombinant Human ATP5O protein, GST-tagged | +Inquiry |
Atp5o-1771M | Recombinant Mouse Atp5o Protein, Myc/DDK-tagged | +Inquiry |
ATP5O-1543HF | Recombinant Full Length Human ATP5O Protein, GST-tagged | +Inquiry |
ATP5O-989H | Recombinant Human ATP5O protein, GST-tagged | +Inquiry |
ATP5O-950H | Recombinant Human ATP5O, 24-213 aa, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5O-8595HCL | Recombinant Human ATP5O 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP5O Products
Required fields are marked with *
My Review for All ATP5O Products
Required fields are marked with *