Recombinant Human ATP6AP2 protein, His-SUMO-tagged
Cat.No. : | ATP6AP2-2573H |
Product Overview : | Recombinant Human ATP6AP2 protein(O75787)(17-350aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 17-350aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ATP6AP2 ATPase, H+ transporting, lysosomal accessory protein 2 [ Homo sapiens ] |
Official Symbol | ATP6AP2 |
Synonyms | ATP6AP2; ATPase, H+ transporting, lysosomal accessory protein 2; ATP6IP2, ATPase, H+ transporting, lysosomal interacting protein 2; renin receptor; APT6M8 9; ATP6M8 9; M8 9; N14F; V-ATPase M8.9 subunit; renin/prorenin receptor; ER-localized type I transmembrane adaptor; embryonic liver differentiation factor 10; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase, H+ transporting, lysosomal interacting protein 2; vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8-9; ATPase, H+ transporting, lysosomal (vacuolar proton pump) membrane sector associated protein M8-9; M8-9; MRXE; XMRE; HT028; ELDF10; ATP6IP2; MSTP009; APT6M8-9; ATP6M8-9; MGC99577; |
Gene ID | 10159 |
mRNA Refseq | NM_005765 |
Protein Refseq | NP_005756 |
MIM | 300556 |
UniProt ID | O75787 |
◆ Recombinant Proteins | ||
ATP6AP2-12263Z | Recombinant Zebrafish ATP6AP2 | +Inquiry |
ATP6AP2-993H | Recombinant Human ATP6AP2 protein, GST-tagged | +Inquiry |
ATP6AP2-2444H | Recombinant Human ATP6AP2, His-tagged | +Inquiry |
ATP6AP2-1399H | Recombinant Human ATP6AP2 Protein (Asn17-Glu302), His tagged | +Inquiry |
ATP6AP2-2184H | Recombinant Human ATP6AP2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ATP6AP2-27064TH | Native Human ATP6AP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6AP2-8591HCL | Recombinant Human ATP6AP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6AP2 Products
Required fields are marked with *
My Review for All ATP6AP2 Products
Required fields are marked with *