Recombinant Human ATP6V0D1 protein, GST-tagged
| Cat.No. : | ATP6V0D1-997H |
| Product Overview : | Human ATP6V0D1 full-length ORF ( AAH08861, 1 a.a. - 351 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 64.35 kDa |
| AA Sequence : | MSFFPEHYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ATP6V0D1 ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 [ Homo sapiens ] |
| Official Symbol | ATP6V0D1 |
| Synonyms | ATP6V0D1; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1; ATP6D, ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 1 , ATPase, H+ transporting, lysosomal 38kDa, V0 subunit D1; V-type proton ATPase subunit d 1; ATP6DV; P39; VATX; Vma6; VPATPD; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump subunit d 1; V-ATPase 40 KDa accessory protein; H(+)-transporting two-sector ATPase, subunit D; ATPase, H+ transporting, lysosomal (vacuolar proton pump), member D; VMA6; ATP6D; FLJ43534; |
| Gene ID | 9114 |
| mRNA Refseq | NM_004691 |
| Protein Refseq | NP_004682 |
| MIM | 607028 |
| UniProt ID | P61421 |
| ◆ Recombinant Proteins | ||
| ATP6V0D1-10021Z | Recombinant Zebrafish ATP6V0D1 | +Inquiry |
| ATP6V0D1-5584C | Recombinant Chicken ATP6V0D1 | +Inquiry |
| ATP6V0D1-1091HF | Recombinant Full Length Human ATP6V0D1 Protein, GST-tagged | +Inquiry |
| ATP6V0D1-10037H | Recombinant Human ATP, His-tagged | +Inquiry |
| ATP6V0D1-2154M | Recombinant Mouse ATP6V0D1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP6V0D1-8588HCL | Recombinant Human ATP6V0D1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V0D1 Products
Required fields are marked with *
My Review for All ATP6V0D1 Products
Required fields are marked with *
