Recombinant Human ATP6V1C1 protein, GST-tagged
Cat.No. : | ATP6V1C1-1003H |
Product Overview : | Human ATP6V1C1 full-length ORF ( NP_001686.1, 1 a.a. - 382 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This gene is one of two genes that encode the V1 domain C subunit proteins and is found ubiquitously. This C subunit is analogous but not homologous to gamma subunit of F-ATPases. Previously, this gene was designated ATP6D. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 70.3 kDa |
AA Sequence : | MTEFWLISAPGEKTCQQTWEKLHAATSKNNNLAVTSKFNIPDLKVGTLDVLVGLSDELAKLDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ATP6V1C1 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [ Homo sapiens ] |
Official Symbol | ATP6V1C1 |
Synonyms | ATP6C; ATP6D; ATP6V1C1; ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD; ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C1; ATPase H+ transporting lysosomal V1 subunit C1; FLJ20057; H(+) transporting two sector ATPase subunit C; H+ ATPase C subunit; H+ transporting ATPase chain C vacuolar; Subunit C of vacuolar proton ATPase V1 domain; V ATPase C subunit; V ATPase subunit C 1; V-ATPase subunit C 1; V-type proton ATPase subunit C 1; Vacuolar ATP synthase subunit C; Vacuolar proton pump 42 kD subunit; Vacuolar proton pump C subunit; Vacuolar proton pump subunit C 1; Vacuolar protonATPase subunit C VI domain; VATC; VATC1_HUMAN; VATPase C subunit; VATPase subunit C 1; VMA5; ATP6V1C1 |
Gene ID | 528 |
mRNA Refseq | NM_001695.4 |
Protein Refseq | NP_001686.1 |
MIM | 603097 |
UniProt ID | P21283 |
◆ Recombinant Proteins | ||
ATP6V1C1-547R | Recombinant Rat ATP6V1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP6V1C1-1527HF | Recombinant Full Length Human ATP6V1C1 Protein, GST-tagged | +Inquiry |
Atp6v1c1-1773M | Recombinant Mouse Atp6v1c1 Protein, Myc/DDK-tagged | +Inquiry |
ATP6V1C1-10043H | Recombinant Human ATP6V1C1, GST-tagged | +Inquiry |
ATP6V1C1-327C | Recombinant Cynomolgus ATP6V1C1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP6V1C1-8582HCL | Recombinant Human ATP6V1C1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATP6V1C1 Products
Required fields are marked with *
My Review for All ATP6V1C1 Products
Required fields are marked with *
0
Inquiry Basket