Recombinant Human ATP6V1C1 Protein, His-tagged
| Cat.No. : | ATP6V1C1-28H |
| Product Overview : | Recombinant Human ATP6V1C1 Protein(P21283)(156-256 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 61-340 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 35 kDa |
| AASequence : | LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYK |
| Storage : | Store at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | ATP6V1C1 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [ Homo sapiens ] |
| Official Symbol | ATP6V1C1 |
| Synonyms | ATP6C; ATP6D; ATP6V1C1; ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD; ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C1; ATPase H+ transporting lysosomal V1 subunit C1; FLJ20057; H(+) transporting two sector ATPase subunit C; H+ ATPase C subunit; H+ transporting ATPase chain C vacuolar; Subunit C of vacuolar proton ATPase V1 domain; V ATPase C subunit; V ATPase subunit C 1; V-ATPase subunit C 1; V-type proton ATPase subunit C 1; Vacuolar ATP synthase subunit C; Vacuolar proton pump 42 kD subunit; Vacuolar proton pump C subunit; Vacuolar proton pump subunit C 1; Vacuolar protonATPase subunit C VI domain; VATC; VATC1_HUMAN; VATPase C subunit; VATPase subunit C 1; VMA5; ATP6V1C1 |
| Gene ID | 528 |
| mRNA Refseq | NM_001695.4 |
| Protein Refseq | NP_001686.1 |
| MIM | 603097 |
| UniProt ID | P21283 |
| ◆ Recombinant Proteins | ||
| ATP6V1C1-877M | Recombinant Mouse ATP6V1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP6V1C1-296R | Recombinant Rhesus Macaque ATP6V1C1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ATP6V1C1-1527HF | Recombinant Full Length Human ATP6V1C1 Protein, GST-tagged | +Inquiry |
| ATP6V1C1-327C | Recombinant Cynomolgus ATP6V1C1 Protein, His-tagged | +Inquiry |
| ATP6V1C1-27H | Recombinant Human ATP6V1C1 Protein, His-SUMO & Strep-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP6V1C1-8582HCL | Recombinant Human ATP6V1C1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP6V1C1 Products
Required fields are marked with *
My Review for All ATP6V1C1 Products
Required fields are marked with *
