Recombinant Human ATP6V1C1 Protein, His-tagged

• Cat.No.: ATP6V1C1-28H
• Product Overview: Recombinant Human ATP6V1C1 Protein(P21283)(156-256 aa), fused with C-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 61-340 aa
• Form: Phosphate buffered saline.
• Molecular Mass: 35 kDa
• AASequence: LDAFVEGVVKKVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNISEIIAKGVTQIDNDLKSRASAYNNLKGNLQNLERKNAGSLLTRSLAEIVKKDDFVLDSEYLVTLLVVVPKLNHNDWIKQYETLAEMVVPRSSNVLSEDQDSYLCNVTLFRKAVDDFRHKARENKFIVRDFQYNEEEMKADKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYK
• Storage: Store at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ATP6V1C1 ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 [ Homo sapiens ]
• Official Symbol: ATP6V1C1
• Synonyms: ATP6C; ATP6D; ATP6V1C1; ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD; ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1; ATPase H+ transporting lysosomal 42kDa V1 subunit C1; ATPase H+ transporting lysosomal V1 subunit C1; FLJ20057; H(+) transporting two sector ATPase subunit C; H+ ATPase C subunit; H+ transporting ATPase chain C vacuolar; Subunit C of vacuolar proton ATPase V1 domain; V ATPase C subunit; V ATPase subunit C 1; V-ATPase subunit C 1; V-type proton ATPase subunit C 1; Vacuolar ATP synthase subunit C; Vacuolar proton pump 42 kD subunit; Vacuolar proton pump C subunit; Vacuolar proton pump subunit C 1; Vacuolar protonATPase subunit C VI domain; VATC; VATC1_HUMAN; VATPase C subunit; VATPase subunit C 1; VMA5; ATP6V1C1
• Gene ID: 528
• mRNA Refseq: NM_001695.4
• Protein Refseq: NP_001686.1
• MIM: 603097
• UniProt ID: P21283