"ATP7A" Related Products

Recombinant Human ATP7A protein, GST-tagged

Cat.No. : ATP7A-1013H
Product Overview : Human ATP7A partial ORF ( NP_000043, 1406 a.a. - 1500 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a transmembrane protein that functions in copper transport across membranes. This protein is localized to the trans Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. It relocalizes to the plasma membrane under conditions of elevated extracellular copper, and functions in the efflux of copper from cells. Mutations in this gene are associated with Menkes disease, X-linked distal spinal muscular atrophy, and occipital horn syndrome. Alternatively-spliced transcript variants have been observed. [provided by RefSeq, Aug 2013]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.19 kDa
AA Sequence : FLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : ATP7A ATPase, Cu++ transporting, alpha polypeptide [ Homo sapiens ]
Official Symbol : ATP7A
Synonyms : ATP7A; ATPase, Cu++ transporting, alpha polypeptide; Menkes syndrome , MNK; copper-transporting ATPase 1; copper pump 1; Cu++-transporting P-type ATPase; Menkes disease-associated protein; MK; MNK; DSMAX; SMAX3; FLJ17790;
Gene ID : 538
mRNA Refseq : NM_000052
Protein Refseq : NP_000043
MIM : 300011
UniProt ID : Q04656

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.