Recombinant Human ATP7B protein, His-tagged
Cat.No. : | ATP7B-1054H |
Product Overview : | Recombinant Human ATP7B protein(P35670)(Pro221-Gln480), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Pro221-Gln480 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 29 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQ |
Gene Name | ATP7B ATPase, Cu++ transporting, beta polypeptide [ Homo sapiens ] |
Official Symbol | ATP7B |
Synonyms | ATP7B; ATPase, Cu++ transporting, beta polypeptide; ATPase, Cu++ transporting, beta polypeptide (Wilson disease) , WND; copper-transporting ATPase 2; Wilson disease; copper pump 2; Wilson disease-associated protein; ATPase, Cu(2+)- transporting, beta polypeptide; WD; PWD; WC1; WND; |
Gene ID | 540 |
mRNA Refseq | NM_000053 |
Protein Refseq | NP_000044 |
MIM | 606882 |
UniProt ID | P35670 |
◆ Recombinant Proteins | ||
ATP7B-3895H | Recombinant Human ATP7B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Atp7b-676M | Recombinant Mouse Atp7b Protein, MYC/DDK-tagged | +Inquiry |
ATP7B-2172M | Recombinant Mouse ATP7B Protein | +Inquiry |
ATP7B-02H | Recombinant Human ATP7B Protein, His tagged | +Inquiry |
ATP7B-1014H | Recombinant Human ATP7B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP7B-8572HCL | Recombinant Human ATP7B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATP7B Products
Required fields are marked with *
My Review for All ATP7B Products
Required fields are marked with *
0
Inquiry Basket