Recombinant Human ATP7B protein, His-tagged

Cat.No. : ATP7B-1054H
Product Overview : Recombinant Human ATP7B protein(P35670)(Pro221-Gln480), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Pro221-Gln480
Tag : C-His
Form : Phosphate buffered saline
Molecular Mass : 29 kDa
Storage : Store at -20°C to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : PIDIERLQSTNPKRPLSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCSTTLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDMGFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQ
Gene Name ATP7B ATPase, Cu++ transporting, beta polypeptide [ Homo sapiens ]
Official Symbol ATP7B
Synonyms ATP7B; ATPase, Cu++ transporting, beta polypeptide; ATPase, Cu++ transporting, beta polypeptide (Wilson disease) , WND; copper-transporting ATPase 2; Wilson disease; copper pump 2; Wilson disease-associated protein; ATPase, Cu(2+)- transporting, beta polypeptide; WD; PWD; WC1; WND;
Gene ID 540
mRNA Refseq NM_000053
Protein Refseq NP_000044
MIM 606882
UniProt ID P35670

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP7B Products

Required fields are marked with *

My Review for All ATP7B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon