Recombinant Human AXIN1 protein, GST-tagged

Cat.No. : AXIN1-1047H
Product Overview : Human AXIN1 partial ORF ( NP_003493, 643 a.a. - 740 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytoplasmic protein which contains a regulation of G-protein signaling (RGS) domain and a dishevelled and axin (DIX) domain. The encoded protein interacts with adenomatosis polyposis coli, catenin beta-1, glycogen synthase kinase 3 beta, protein phosphate 2, and itself. This protein functions as a negative regulator of the wingless-type MMTV integration site family, member 1 (WNT) signaling pathway and can induce apoptosis. The crystal structure of a portion of this protein, alone and in a complex with other proteins, has been resolved. Mutations in this gene have been associated with hepatocellular carcinoma, hepatoblastomas, ovarian endometriod adenocarcinomas, and medullablastomas. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Molecular Mass : 36.52 kDa
AA Sequence : ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AXIN1 axin 1 [ Homo sapiens ]
Official Symbol AXIN1
Synonyms AXIN1; axin 1; axin-1; PPP1R49; protein phosphatase 1; regulatory subunit 49; axis inhibitor 1; fused, mouse, homolog of; axis inhibition protein 1; protein phosphatase 1, regulatory subunit 49; AXIN; MGC52315;
Gene ID 8312
mRNA Refseq NM_003502
Protein Refseq NP_003493
MIM 603816
UniProt ID O15169

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AXIN1 Products

Required fields are marked with *

My Review for All AXIN1 Products

Required fields are marked with *

0
cart-icon