Recombinant Human B3GNT3 protein, GST-tagged

Cat.No. : B3GNT3-021H
Product Overview : Human B3GNT3 partial ORF ( NP_055071, 135 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq]
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33.88 kDa
AA Sequence : KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name B3GNT3 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [ Homo sapiens ]
Official Symbol B3GNT3
Synonyms B3GNT3; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3; TMEM3; B3GN T3; B3GNT 3; beta 1; 3 N acetylglucosaminyltransferase bGnT 3; beta3Gn T3; HP10328; putative type II membrane protein; transmembrane protein 3; beta3GalT8; beta-3-Gx-T8; beta-1,3-Gn-T3; beta-1,3-GalTase 8; core1-beta3GlcNAcT; beta-1,3-N-acetylglucosaminyltransferase bGnT-3; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8; core 1 extending beta-1,3-N-acetylglucosaminyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8; B3GN-T3; B3GNT-3; B3GAL-T8; beta3Gn-T3;
Gene ID 10331
mRNA Refseq NM_014256
Protein Refseq NP_055071
MIM 605863
UniProt ID Q9Y2A9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All B3GNT3 Products

Required fields are marked with *

My Review for All B3GNT3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon