Recombinant Human B3GNT3 protein, GST-tagged
| Cat.No. : | B3GNT3-021H |
| Product Overview : | Human B3GNT3 partial ORF ( NP_055071, 135 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase family. This enzyme is a type II transmembrane protein and contains a signal anchor that is not cleaved. It prefers the substrates of lacto-N-tetraose and lacto-N-neotetraose, and is involved in the biosynthesis of poly-N-acetyllactosamine chains and the biosynthesis of the backbone structure of dimeric sialyl Lewis a. It plays dominant roles in L-selectin ligand biosynthesis, lymphocyte homing and lymphocyte trafficking. [provided by RefSeq] |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 33.88 kDa |
| AA Sequence : | KVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLN |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | B3GNT3 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [ Homo sapiens ] |
| Official Symbol | B3GNT3 |
| Synonyms | B3GNT3; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3; TMEM3; B3GN T3; B3GNT 3; beta 1; 3 N acetylglucosaminyltransferase bGnT 3; beta3Gn T3; HP10328; putative type II membrane protein; transmembrane protein 3; beta3GalT8; beta-3-Gx-T8; beta-1,3-Gn-T3; beta-1,3-GalTase 8; core1-beta3GlcNAcT; beta-1,3-N-acetylglucosaminyltransferase bGnT-3; UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8; core 1 extending beta-1,3-N-acetylglucosaminyltransferase; UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8; B3GN-T3; B3GNT-3; B3GAL-T8; beta3Gn-T3; |
| Gene ID | 10331 |
| mRNA Refseq | NM_014256 |
| Protein Refseq | NP_055071 |
| MIM | 605863 |
| UniProt ID | Q9Y2A9 |
| ◆ Recombinant Proteins | ||
| B3GNT3-10104H | Recombinant Human B3GNT3, His-tagged | +Inquiry |
| B3GNT3-291H | Recombinant Human B3GNT3 Protein, His-tagged | +Inquiry |
| B3GNT3-021H | Recombinant Human B3GNT3 protein, GST-tagged | +Inquiry |
| B3GNT3-6108Z | Recombinant Zebrafish B3GNT3 | +Inquiry |
| B3GNT3-020H | Recombinant Human B3GNT3 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| B3GNT3-8543HCL | Recombinant Human B3GNT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B3GNT3 Products
Required fields are marked with *
My Review for All B3GNT3 Products
Required fields are marked with *
