Recombinant Human BAK1
Cat.No. : | BAK1-26168TH |
Product Overview : | Recombinant fragment corresponding to amino acids 100-211 of Human Bak with an N terminal proprietary tag; Predicted MWt 37.95 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 112 amino acids |
Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
Molecular Weight : | 37.950kDa inclusive of tags |
Tissue specificity : | Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLA LHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVA ALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
Sequence Similarities : | Belongs to the Bcl-2 family. |
Gene Name | BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ] |
Official Symbol | BAK1 |
Synonyms | BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; |
Gene ID | 578 |
mRNA Refseq | NM_001188 |
Protein Refseq | NP_001179 |
MIM | 600516 |
Uniprot ID | Q16611 |
Chromosome Location | 6p21.31 |
Pathway | Activation and oligomerization of BAK protein, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Intrinsic Pathway for Apoptosis, organism-specific biosystem; |
Function | BH domain binding; chaperone binding; heat shock protein binding; identical protein binding; metal ion binding; |
◆ Recombinant Proteins | ||
BAK1-2609C | Recombinant Chicken BAK1 | +Inquiry |
BAK1-35H | Recombinant Human BAK1 Protein, His-tagged | +Inquiry |
RFL36987HF | Recombinant Full Length Human Bcl-2 Homologous Antagonist/Killer(Bak1) Protein, His-Tagged | +Inquiry |
BAK1-26168TH | Recombinant Human BAK1 | +Inquiry |
RFL9990MF | Recombinant Full Length Mouse Bcl-2 Homologous Antagonist/Killer(Bak1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAK1 Products
Required fields are marked with *
My Review for All BAK1 Products
Required fields are marked with *
0
Inquiry Basket