Recombinant Human BAK1

Cat.No. : BAK1-26168TH
Product Overview : Recombinant fragment corresponding to amino acids 100-211 of Human Bak with an N terminal proprietary tag; Predicted MWt 37.95 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 112 amino acids
Description : The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Molecular Weight : 37.950kDa inclusive of tags
Tissue specificity : Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLA LHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVA ALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS
Sequence Similarities : Belongs to the Bcl-2 family.
Gene Name BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ]
Official Symbol BAK1
Synonyms BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7;
Gene ID 578
mRNA Refseq NM_001188
Protein Refseq NP_001179
MIM 600516
Uniprot ID Q16611
Chromosome Location 6p21.31
Pathway Activation and oligomerization of BAK protein, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Intrinsic Pathway for Apoptosis, organism-specific biosystem;
Function BH domain binding; chaperone binding; heat shock protein binding; identical protein binding; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAK1 Products

Required fields are marked with *

My Review for All BAK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon