Recombinant Human BAK1
| Cat.No. : | BAK1-26168TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 100-211 of Human Bak with an N terminal proprietary tag; Predicted MWt 37.95 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 112 amino acids |
| Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress. |
| Molecular Weight : | 37.950kDa inclusive of tags |
| Tissue specificity : | Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLA LHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVA ALNLGNGPILNVLVVLGVVLLGQFVVRRFFKS |
| Sequence Similarities : | Belongs to the Bcl-2 family. |
| Gene Name | BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ] |
| Official Symbol | BAK1 |
| Synonyms | BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; |
| Gene ID | 578 |
| mRNA Refseq | NM_001188 |
| Protein Refseq | NP_001179 |
| MIM | 600516 |
| Uniprot ID | Q16611 |
| Chromosome Location | 6p21.31 |
| Pathway | Activation and oligomerization of BAK protein, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Intrinsic Pathway for Apoptosis, organism-specific biosystem; |
| Function | BH domain binding; chaperone binding; heat shock protein binding; identical protein binding; metal ion binding; |
| ◆ Recombinant Proteins | ||
| BAK1-337R | Recombinant Rhesus Macaque BAK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAK1-36H | Recombinant Human BAK1 protein, His-tagged | +Inquiry |
| BAK1-001H | Recombinant Human BAK1 Protein, His tagged | +Inquiry |
| BAK1-26168TH | Recombinant Human BAK1 | +Inquiry |
| BAK1-509R | Recombinant Rhesus monkey BAK1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAK1 Products
Required fields are marked with *
My Review for All BAK1 Products
Required fields are marked with *
