Recombinant Human BAK1 Protein, His tagged

Cat.No. : BAK1-001H
Product Overview : Recombinant Human BAK1 Protein (1-124 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-124 aa
Description : The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
AASequence : MHHHHHHHHDYKDDDDKMASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGIN
Molecular Mass : 16 kDa
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 0.1% SKL
Concentration : 0.24 mg/mL by BCA
Gene Name BAK1 BCL2-antagonist/killer 1 [ Homo sapiens (human) ]
Official Symbol BAK1
Synonyms BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; bcl2-L-7; BCL2-like 7 protein; bcl-2-like protein 7; apoptosis regulator BAK; pro-apoptotic protein BAK; BAK-LIKE; MGC3887; MGC117255;
Gene ID 578
mRNA Refseq NM_001188
Protein Refseq NP_001179
MIM 600516
UniProt ID Q16611

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAK1 Products

Required fields are marked with *

My Review for All BAK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon