Recombinant Human BAK1 Protein, His tagged

• Cat.No.: BAK1-001H
• Product Overview: Recombinant Human BAK1 Protein (1-124 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-124 aa
• Description: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
• AASequence: MHHHHHHHHDYKDDDDKMASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGIN
• Molecular Mass: 16 kDa
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 0.1% SKL
• Concentration: 0.24 mg/mL by BCA

Gene Information

• Gene Name: BAK1 BCL2-antagonist/killer 1 [ Homo sapiens (human) ]
• Official Symbol: BAK1
• Synonyms: BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; bcl2-L-7; BCL2-like 7 protein; bcl-2-like protein 7; apoptosis regulator BAK; pro-apoptotic protein BAK; BAK-LIKE; MGC3887; MGC117255
• Gene ID: 578
• mRNA Refseq: NM_001188
• Protein Refseq: NP_001179
• MIM: 600516
• UniProt ID: Q16611