Recombinant Human BAK1 protein, His-tagged
Cat.No. : | BAK1-35H |
Product Overview : | Recombinant Human BAK1 protein(1-100 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-100 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AASequence : | MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | BAK1 BCL2-antagonist/killer 1 [ Homo sapiens ] |
Official Symbol | BAK1 |
Synonyms | BAK1; BCL2-antagonist/killer 1; CDN1; bcl-2 homologous antagonist/killer; BAK; BCL2L7; bcl2-L-7; BCL2-like 7 protein; bcl-2-like protein 7; apoptosis regulator BAK; pro-apoptotic protein BAK; BAK-LIKE; MGC3887; MGC117255; |
Gene ID | 578 |
mRNA Refseq | NM_001188 |
Protein Refseq | NP_001179 |
MIM | 600516 |
UniProt ID | Q16611 |
◆ Recombinant Proteins | ||
BAK1-26166TH | Recombinant Full Length Human BAK1 Protein, GST tagged | +Inquiry |
RFL36987HF | Recombinant Full Length Human Bcl-2 Homologous Antagonist/Killer(Bak1) Protein, His-Tagged | +Inquiry |
BAK1-26168TH | Recombinant Human BAK1 | +Inquiry |
BAK1-509R | Recombinant Rhesus monkey BAK1 Protein, His-tagged | +Inquiry |
BAK1-36H | Recombinant Human BAK1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
BAK1-001H | Recombinant Human BAK1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAK1-8519HCL | Recombinant Human BAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAK1 Products
Required fields are marked with *
My Review for All BAK1 Products
Required fields are marked with *