Recombinant Human BCAP31 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BCAP31-5103H
• Product Overview: BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16.
• Molecular Mass: 34.6 kDa
• AA Sequence: MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRMSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BCAP31 B-cell receptor-associated protein 31 [ Homo sapiens (human) ]
• Official Symbol: BCAP31
• Synonyms: BCAP31; B-cell receptor-associated protein 31; 6C6 Ag; BAP31; CDM; DXS1357E; p28 Bap31; BCR-associated protein Bap31; 6C6-AG tumor-associated antigen; 6C6-AG
• Gene ID: 10134
• mRNA Refseq: NM_001139457
• Protein Refseq: NP_001132929
• MIM: 300398
• UniProt ID: P51572