Recombinant Human BFSP1 Protein, GST-tagged

Cat.No. : BFSP1-203H
Product Overview : Human BFSP1 partial ORF ( NP_001186, 567 a.a. - 664 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and the protein product of this gene, filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene are the cause of autosomal recessive cortical juvenile-onset cataract. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.52 kDa
AA Sequence : EESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEKISTESIQTYEETAVIVETMIGKTKSDKKKSGEKS
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BFSP1 beaded filament structural protein 1, filensin [ Homo sapiens ]
Official Symbol BFSP1
Synonyms BFSP1; beaded filament structural protein 1, filensin; filensin; CP94; CP115; LIFL H; cytoskeletal protein, 115 KD; lens intermediate filament-like heavy; lens fiber cell beaded-filament structural protein CP 115; LIFL-H;
Gene ID 631
mRNA Refseq NM_001161705
Protein Refseq NP_001155177
MIM 603307
UniProt ID Q12934

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BFSP1 Products

Required fields are marked with *

My Review for All BFSP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon