Recombinant Human BIK Protein, GST-tagged

• Cat.No.: BIK-219H
• Product Overview: Human BIK full-length ORF ( AAH01599, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is known to interact with cellular and viral survival-promoting proteins, such as BCL2 and the Epstein-Barr virus in order to enhance programed cell death. Because its activity is suppressed in the presence of survival-promoting proteins, this protein is suggested as a likely target for antiapoptotic proteins. This protein shares a critical BH3 domain with other death-promoting proteins, BAX and BAK.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 43.23 kDa
• AA Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BIK BCL2-interacting killer (apoptosis-inducing) [ Homo sapiens ]
• Official Symbol: BIK
• Synonyms: BIK; BCL2-interacting killer (apoptosis-inducing); bcl-2-interacting killer; NBK; apoptosis inducer NBK; apoptosis-inducing NBK; BP4; BIP1
• Gene ID: 638
• mRNA Refseq: NM_001197
• Protein Refseq: NP_001188
• MIM: 603392
• UniProt ID: Q13323