Recombinant Human BIK Protein, GST-tagged
Cat.No. : | BIK-219H |
Product Overview : | Human BIK full-length ORF ( AAH01599, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is known to interact with cellular and viral survival-promoting proteins, such as BCL2 and the Epstein-Barr virus in order to enhance programed cell death. Because its activity is suppressed in the presence of survival-promoting proteins, this protein is suggested as a likely target for antiapoptotic proteins. This protein shares a critical BH3 domain with other death-promoting proteins, BAX and BAK. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.23 kDa |
AA Sequence : | MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BIK BCL2-interacting killer (apoptosis-inducing) [ Homo sapiens ] |
Official Symbol | BIK |
Synonyms | BIK; BCL2-interacting killer (apoptosis-inducing); bcl-2-interacting killer; NBK; apoptosis inducer NBK; apoptosis-inducing NBK; BP4; BIP1; |
Gene ID | 638 |
mRNA Refseq | NM_001197 |
Protein Refseq | NP_001188 |
MIM | 603392 |
UniProt ID | Q13323 |
◆ Recombinant Proteins | ||
RFL31368HF | Recombinant Full Length Human Bcl-2-Interacting Killer(Bik) Protein, His-Tagged | +Inquiry |
BIK-2405M | Recombinant Mouse BIK Protein | +Inquiry |
BIK-4106Z | Recombinant Zebrafish BIK | +Inquiry |
BIK-219H | Recombinant Human BIK Protein, GST-tagged | +Inquiry |
BIK-220H | Recombinant Human BIK Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIK-65HCL | Recombinant Human BIK lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BIK Products
Required fields are marked with *
My Review for All BIK Products
Required fields are marked with *
0
Inquiry Basket