Recombinant Human BMP1 protein, GST-tagged
| Cat.No. : | BMP1-30198H |
| Product Overview : | Recombinant Human BMP1 (58-140 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Leu1-Gly140 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | LDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | BMP1 bone morphogenetic protein 1 [ Homo sapiens ] |
| Official Symbol | BMP1 |
| Synonyms | BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432; |
| Gene ID | 649 |
| mRNA Refseq | NM_001199 |
| Protein Refseq | NP_001190 |
| MIM | 112264 |
| UniProt ID | P13497 |
| ◆ Recombinant Proteins | ||
| Bmp1-4004M | Recombinant Mouse Bmp1 Protein (Glu615-Ser848), N-GST tagged | +Inquiry |
| BMP1-256H | Recombinant Human BMP1 Protein, GST-tagged | +Inquiry |
| Bmp1-663M | Recombinant Mouse Bmp1 protein, His-tagged | +Inquiry |
| BMP1-10247H | Recombinant Human BMP1, His-tagged | +Inquiry |
| BMP1-662H | Recombinant Human BMP1 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP1 Products
Required fields are marked with *
My Review for All BMP1 Products
Required fields are marked with *
