Recombinant Human BMP6 Protein, GST-tagged

Cat.No. : BMP6-273H
Product Overview : Human BMP6 partial ORF ( NP_001709, 382 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 35.64 kDa
AA Sequence : QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPE
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BMP6 bone morphogenetic protein 6 [ Homo sapiens ]
Official Symbol BMP6
Synonyms BMP6; bone morphogenetic protein 6; vegetal related growth factor (TGFB related) , VGR; VGR1; BMP-6; VGR-1; VG-1-R; VG-1-related protein; Vg1-related sequence; vegetal-related (TGFB related) cytokine; vegetal related growth factor (TGFB-related); VGR;
Gene ID 654
mRNA Refseq NM_001718
Protein Refseq NP_001709
MIM 112266
UniProt ID P22004

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP6 Products

Required fields are marked with *

My Review for All BMP6 Products

Required fields are marked with *

0
cart-icon