Recombinant Human BMP6 Protein, GST-tagged
Cat.No. : | BMP6-273H |
Product Overview : | Human BMP6 partial ORF ( NP_001709, 382 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPE |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMP6 bone morphogenetic protein 6 [ Homo sapiens ] |
Official Symbol | BMP6 |
Synonyms | BMP6; bone morphogenetic protein 6; vegetal related growth factor (TGFB related) , VGR; VGR1; BMP-6; VGR-1; VG-1-R; VG-1-related protein; Vg1-related sequence; vegetal-related (TGFB related) cytokine; vegetal related growth factor (TGFB-related); VGR; |
Gene ID | 654 |
mRNA Refseq | NM_001718 |
Protein Refseq | NP_001709 |
MIM | 112266 |
UniProt ID | P22004 |
◆ Recombinant Proteins | ||
Bmp6-655R | Recombinant Rat Bmp6 protein, His-tagged | +Inquiry |
BMP6-41H | Recombinant Human BMP6 | +Inquiry |
BMP6-998R | Recombinant Rat BMP6 Protein | +Inquiry |
Bmp6-27M | Recombinant Mouse Bone Morphogenetic Protein 6 | +Inquiry |
BMP6-5977H | Recombinant Human BMP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP6-8430HCL | Recombinant Human BMP6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMP6 Products
Required fields are marked with *
My Review for All BMP6 Products
Required fields are marked with *